Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 121 (08 May 2019)
Sequence version 3 (08 Nov 2005)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Myosin-11

Gene

Myh11

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Muscle contraction.Curated

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi34 – 41ATPBy similarity8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • actin binding Source: UniProtKB-KW
  • ATP binding Source: UniProtKB-KW
  • calmodulin binding Source: UniProtKB-KW
  • motor activity Source: InterPro
  • structural constituent of muscle Source: UniProtKB

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding, Calmodulin-binding, Motor protein, Muscle protein, Myosin
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-RNO-445355 Smooth Muscle Contraction
R-RNO-5627123 RHO GTPases activate PAKs

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Myosin-11
Alternative name(s):
Myosin heavy chain 11
Myosin heavy chain, smooth muscle isoform
SMMHC
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Myh11Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Rat genome database

More...
RGDi
3136 Myh11

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Thick filament

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000123428‹1 – 1327Myosin-11Add BLAST›1327

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1039PhosphoserineCombined sources1
Modified residuei1077PhosphoserineCombined sources1
Modified residuei1306PhosphothreonineCombined sources1
Modified residuei1309PhosphoserineCombined sources1
Modified residuei1326PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q63862

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q63862

PRoteomics IDEntifications database

More...
PRIDEi
Q63862

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q63862

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Both isoform 1 and isoform 2 are detected in small and large intestine, uterus, bladder, aorta, stomach, and at much lower levels in lung. All three isoforms are coexpressed in smooth muscle. Isoform 2 predominates in most of the smooth muscles tested, with the exception of intestine and urinary bladder, which show greater expression of isoform 1.2 Publications

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Muscle myosin is a hexameric protein that consists of 2 heavy chain subunits (MHC), 2 alkali light chain subunits (MLC) and 2 regulatory light chain subunits (MLC-2).

Curated

GO - Molecular functioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q63862, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10116.ENSRNOP00000043197

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q63862

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini‹1 – 646Myosin motorPROSITE-ProRule annotationAdd BLAST›646
Domaini649 – 678IQPROSITE-ProRule annotationAdd BLAST30

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni524 – 546Actin-bindingBy similarityAdd BLAST23
Regioni625 – 639Actin-bindingBy similarityAdd BLAST15
Regioni1290 – 1327C-terminalAdd BLAST38

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili707 – 1289Sequence analysisAdd BLAST583

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The rodlike tail sequence is highly repetitive, showing cycles of a 28-residue repeat pattern composed of 4 heptapeptides, characteristic for alpha-helical coiled coils.Curated
Limited proteolysis of myosin heavy chain produces 1 light meromyosin (LMM) and 1 heavy meromyosin (HMM). HMM can be further cleaved into 2 globular subfragments (S1) and 1 rod-shaped subfragment (S2).Curated

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0161 Eukaryota
COG5022 LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000173958

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q63862

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q63862

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.850.10, 1 hit
4.10.270.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000048 IQ_motif_EF-hand-BS
IPR036961 Kinesin_motor_dom_sf
IPR001609 Myosin_head_motor_dom
IPR027401 Myosin_IQ_contain_sf
IPR002928 Myosin_tail
IPR027417 P-loop_NTPase

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00063 Myosin_head, 1 hit
PF01576 Myosin_tail_1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00193 MYOSINHEAVY

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00242 MYSc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50096 IQ, 1 hit
PS51456 MYOSIN_MOTOR, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Fragments.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: Q63862-1) [UniParc]FASTAAdd to basket
Also known as: SM1B1 Publication

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
KKRHEMPPHI YAIADTAYRS MLQDREDQSI LCTGESGAGK TENTKKVIQY
60 70 80 90 100
LAVVASSHKG KKDSSITQGP SFAYGELEKQ LLQANPILEA FGNAKTVKND
110 120 130 140 150
NSSRFGKFIR INFDVTGYIV GANIETYLLE KSRAIRHARD ERTFHIFYYL
160 170 180 190 200
IAGAKEKMRN DLLLESFNSY TFLSNGFVPI PAAQDDEMFQ ETLEAMSIMG
210 220 230 240 250
FSEEEQLAIL KVVSSVLQLG NIVFKKERNT DQASMPDNTA AQKVCHLVGI
260 270 280 290 300
NVTDFTRAIL TPRIKVGRDV VQKAQTKEQA DFAIEALAKA TYERLFRWIL
310 320 330 340 350
SRVNKALDKT HRQGASFLGI LDIAGFEIFE VNSFEQLCIN YTNEKLQQLF
360 370 380 390 400
NHTMFILEQE EYQREGIEWN FIDFGLDLQP CIELIERPNN PPGVLALLDE
410 420 430 440 450
ECWFPKATDK SFVEKLCSEQ GNHPKFQKPK QLKDKTEFSI IHYAGKVDYN
460 470 480 490 500
ASAWLTKNMD PLNDNVTSLL NASSDKFVAD LWKDVDRIVG LDQMAKMTES
510 520 530 540 550
SLPSASKTKK GMFRTVGQLY KEQLGKLMTT LRNTTPNFVR CIIPNHEKRS
560 570 580 590 600
GKLDAFLVLE QLRCNGVLEG IRICRQGFPN RIVFQEFRQR YEILAANAIP
610 620 630 640 650
KGFMDGKQAC ILMIKALELD PNLYRIGQSK IFFRTGVLAH LEEERDLKIT
660 670 680 690 700
DVIMAFQAMC RGYLARKAFT KRQQQLTASK VIQRNCAAYL KLRNWQWWRL
710 720 730 740 750
FTKVKPLDEE MEAKQNLERH VSTLNIQLSD SKKKLQDLAS TIEVMEEGKK
760 770 780 790 800
RLQKEMEGLG QQYEEKAAAY DKLEKTKNRL QQELDDLVVD LDNQRQLVSN
810 820 830 840 850
LEKKQKKFDQ LLAEEKNISS KYADERDRAE AEAREKETKA LSLARALEEA
860 870 880 890 900
LEAKEELERT NKMLKAEMED LVSSKDDVGK NVHELEKSKR ALETQMEEMR
910 920 930 940 950
TQLEELEDEL QATEDAKLRL EVNMQALKGQ FERDLQARDE QNEEKRRQLQ
960 970 980 990 1000
RQLHEYETEL EDERKQRALA AAAKKKLEGD LKDLELQADS AVKGREEAIK
1010 1020 1030 1040 1050
QLRKLQAQMK DFQRELDDAR ASRDEIFATS KENEKKAKSL EAELMQLQED
1060 1070 1080 1090 1100
LAAAERARKQ ADLEKEELAE ELASSLSGRN TLQDEKRRLE ARIAQLEEEL
1110 1120 1130 1140 1150
EEEQGNMEAM SDRVRKATLQ AEQLSNELVT ERSAAQKNES ARQQLERQNK
1160 1170 1180 1190 1200
ELRSKLQEVE GAVKAKLKST VAALEAKIVQ LEEQIEQEAR EKQAATKLLK
1210 1220 1230 1240 1250
QKDKKLKEVL LQVEDERKMV EQYKEQAEKG NTKVKQLKRQ LEEAEEESQR
1260 1270 1280 1290 1300
INANRRKLQR ELDEATESNE AMGREVNALK SKLRRGNEAS FVPSRRAGGR
1310 1320
RVIENTDGSE EEMDARDSDF NGTKASE
Length:1,327
Mass (Da):152,492
Last modified:November 8, 2005 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEE56D86984389F04
GO
Isoform 21 Publication (identifier: Q63862-2) [UniParc]FASTAAdd to basket
Also known as: SM1A1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     61-67: Missing.

Show »
Length:1,320
Mass (Da):151,732
Checksum:i9B8207E5758FA633
GO
Isoform 31 Publication (identifier: Q63862-3) [UniParc]FASTAAdd to basket
Also known as: SM21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1285-1327: RGNEASFVPSRRAGGRRVIENTDGSEEEMDARDSDFNGTKASE → GPPPQETSQ

Show »
Length:1,293
Mass (Da):148,730
Checksum:i4FFC81043153443B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0G2K6S9A0A0G2K6S9_RAT
Myosin-11
Myh11
1,979Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PTU4E9PTU4_RAT
Myosin-11
Myh11
1,972Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section is used for sequence fragments to indicate that the residue at the extremity of the sequence is not the actual terminal residue in the complete protein sequence.<p><a href='/help/non_ter' target='_top'>More...</a></p>Non-terminal residuei1Curated1
<p>This subsection of the ‘Sequence’ section is used to indicate that two residues in a sequence are not consecutive and that there is an undetermined number of unsequenced residues between them.<p><a href='/help/non_cons' target='_top'>More...</a></p>Non-adjacent residuesi706 – 707Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_05091461 – 67Missing in isoform 2. 1 Publication7
Alternative sequenceiVSP_0509151285 – 1327RGNEA…TKASE → GPPPQETSQ in isoform 3. 1 PublicationAdd BLAST43

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY953023 mRNA Translation: AAX51987.1
S61948 mRNA Translation: AAB26775.1
X16261 mRNA Translation: CAA34347.1
X16262 mRNA Translation: CAA34348.1

Protein sequence database of the Protein Information Resource

More...
PIRi
S07537
S10450

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY953023 mRNA Translation: AAX51987.1
S61948 mRNA Translation: AAB26775.1
X16261 mRNA Translation: CAA34347.1
X16262 mRNA Translation: CAA34348.1
PIRiS07537
S10450

3D structure databases

SMRiQ63862
ModBaseiSearch...

Protein-protein interaction databases

IntActiQ63862, 1 interactor
STRINGi10116.ENSRNOP00000043197

PTM databases

iPTMnetiQ63862

Proteomic databases

jPOSTiQ63862
PaxDbiQ63862
PRIDEiQ63862

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Organism-specific databases

RGDi3136 Myh11

Phylogenomic databases

eggNOGiKOG0161 Eukaryota
COG5022 LUCA
HOGENOMiHOG000173958
InParanoidiQ63862
PhylomeDBiQ63862

Enzyme and pathway databases

ReactomeiR-RNO-445355 Smooth Muscle Contraction
R-RNO-5627123 RHO GTPases activate PAKs

Family and domain databases

Gene3Di3.40.850.10, 1 hit
4.10.270.10, 1 hit
InterProiView protein in InterPro
IPR000048 IQ_motif_EF-hand-BS
IPR036961 Kinesin_motor_dom_sf
IPR001609 Myosin_head_motor_dom
IPR027401 Myosin_IQ_contain_sf
IPR002928 Myosin_tail
IPR027417 P-loop_NTPase
PfamiView protein in Pfam
PF00063 Myosin_head, 1 hit
PF01576 Myosin_tail_1, 1 hit
PRINTSiPR00193 MYOSINHEAVY
SMARTiView protein in SMART
SM00242 MYSc, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50096 IQ, 1 hit
PS51456 MYOSIN_MOTOR, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMYH11_RAT
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q63862
Secondary accession number(s): Q58GJ0
, Q63338, Q63339, Q63861
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 13, 2004
Last sequence update: November 8, 2005
Last modified: May 8, 2019
This is version 121 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again