Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 181 (07 Oct 2020)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Add a publicationFeedback
Protein

Phosphatidylinositol 3-kinase regulatory subunit alpha

Gene

Pik3r1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Binds to activated (phosphorylated) protein-Tyr kinases, through its SH2 domain, and acts as an adapter, mediating the association of the p110 catalytic unit to the plasma membrane. Necessary for the insulin-stimulated increase in glucose uptake and glycogen synthesis in insulin-sensitive tissues. Plays an important role in signaling in response to FGFR1, FGFR2, FGFR3, FGFR4, KITLG/SCF, KIT, PDGFRA and PDGFRB. Likewise, plays a role in ITGB2 signaling. Modulates the cellular response to ER stress by promoting nuclear translocation of XBP1 in a ER stress- and/or insulin-dependent manner during metabolic overloading in the liver and hence plays a role in glucose tolerance improvement (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processProtein transport, Stress response, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-RNO-109704, PI3K Cascade
R-RNO-112399, IRS-mediated signalling
R-RNO-114604, GPVI-mediated activation cascade
R-RNO-1250342, PI3K events in ERBB4 signaling
R-RNO-1257604, PIP3 activates AKT signaling
R-RNO-1266695, Interleukin-7 signaling
R-RNO-1433557, Signaling by SCF-KIT
R-RNO-1660499, Synthesis of PIPs at the plasma membrane
R-RNO-180292, GAB1 signalosome
R-RNO-186763, Downstream signal transduction
R-RNO-1963642, PI3K events in ERBB2 signaling
R-RNO-198203, PI3K/AKT activation
R-RNO-202424, Downstream TCR signaling
R-RNO-2029485, Role of phospholipids in phagocytosis
R-RNO-210993, Tie2 Signaling
R-RNO-2424491, DAP12 signaling
R-RNO-2730905, Role of LAT2/NTAL/LAB on calcium mobilization
R-RNO-388841, Costimulation by the CD28 family
R-RNO-389357, CD28 dependent PI3K/Akt signaling
R-RNO-416476, G alpha (q) signalling events
R-RNO-430116, GP1b-IX-V activation signalling
R-RNO-4420097, VEGFA-VEGFR2 Pathway
R-RNO-512988, Interleukin-3, Interleukin-5 and GM-CSF signaling
R-RNO-5654689, PI-3K cascade:FGFR1
R-RNO-5654695, PI-3K cascade:FGFR2
R-RNO-5654710, PI-3K cascade:FGFR3
R-RNO-5654720, PI-3K cascade:FGFR4
R-RNO-6811558, PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
R-RNO-8851907, MET activates PI3K/AKT signaling
R-RNO-8853659, RET signaling
R-RNO-9009391, Extra-nuclear estrogen signaling
R-RNO-9027276, Erythropoietin activates Phosphoinositide-3-kinase (PI3K)
R-RNO-912526, Interleukin receptor SHC signaling
R-RNO-912631, Regulation of signaling by CBL
R-RNO-983695, Antigen activates B Cell Receptor (BCR) leading to generation of second messengers

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Phosphatidylinositol 3-kinase regulatory subunit alpha
Short name:
PI3-kinase regulatory subunit alpha
Short name:
PI3K regulatory subunit alpha
Short name:
PtdIns-3-kinase regulatory subunit alpha
Alternative name(s):
Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha
Short name:
PI3-kinase subunit p85-alpha
Short name:
PtdIns-3-kinase regulatory subunit p85-alpha
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Pik3r1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Rat genome database

More...
RGDi
3329, Pik3r1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000807602 – 724Phosphatidylinositol 3-kinase regulatory subunit alphaAdd BLAST723

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineBy similarity1
Modified residuei154PhosphoserineBy similarity1
Modified residuei279PhosphoserineBy similarity1
Modified residuei467PhosphotyrosineBy similarity1
Modified residuei580PhosphotyrosineBy similarity1
Modified residuei608PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Polyubiquitinated in T-cells by CBLB; which does not promote proteasomal degradation but impairs association with CD28 and CD3Z upon T-cell activation.By similarity
Phosphorylated. Tyrosine phosphorylated in response to signaling by FGFR1, FGFR2, FGFR3 and FGFR4. Phosphorylated by CSF1R. Phosphorylated on tyrosine residues by TEK/TIE2. Dephosphorylated by PTPRJ. Phosphorylated by PIK3CA at Ser-608; phosphorylation is stimulated by insulin and PDGF. The relevance of phosphorylation by PIK3CA is however unclear. Phosphorylated in response to KIT and KITLG/SCF. Phosphorylated by FGR and ERBB4 (By similarity).By similarity

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q63787

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q63787

PRoteomics IDEntifications database

More...
PRIDEi
Q63787

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q63787

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q63787

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

The P85-alpha isoform is widely expressed. Expression of the P55-alpha isoform is highest in brain and skeletal muscle. The P50-alpha isoform is abundant in liver with lower levels in brain and muscle.

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer of a regulatory subunit PIK3R1 and a p110 catalytic subunit (PIK3CA, PIK3CB or PIK3CD).

Interacts (via SH2 domains) with CCDC88A/GIV (tyrosine-phosphorylated form); the interaction enables recruitment of PIK3R1 to the EGFR receptor, enhancing PI3K activity and cell migration (By similarity).

Interacts with phosphorylated LAT, LAX1, TRAT1 and LIME1 upon TCR and/or activation.

Interacts with phosphorylated TOM1L1.

Interacts with CBLB. The SH2 domains interact with the YTHM motif of phosphorylated INSR in vitro.

Also interacts with tyrosine-phosphorylated IGF1R in vitro.

Interacts with CD28 and CD3Z upon T-cell activation.

Interacts with NISCH, SOCS7 and HCST.

Interacts with RUFY3.

Interacts with AXL, FASLG, FER, FGR, HCK, KIT and BCR.

Interacts with PDGFRA (tyrosine phosphorylated) and PDGFRB (tyrosine phosphorylated).

Interacts (via SH2 domain) with CSF1R (tyrosine phosphorylated).

Interacts with ERBB4 (phosphorylated).

Interacts (via SH2 domain) with TEK/TIE2 (tyrosine phosphorylated).

Interacts with LYN (via SH3 domain); this enhances enzyme activity.

Interacts with NTRK1 (phosphorylated upon ligand-binding).

Interacts with PIK3R2; the interaction is dissociated in an insulin-dependent manner.

Interacts with XBP1; the interaction is direct and induces translocation of XBP1 into the nucleus in a ER stress- and/or insulin-dependent but PI3K-independent manner (By similarity).

Interacts with FGFR1, FGFR2, FGFR3 and FGFR4 (phosphorylated) (Probable).

Interacts with IRS1 and phosphorylated IRS4 (PubMed:8628286).

Interacts with PTK2/FAK1 (PubMed:8824286).

Interacts with FAM83B; activates the PI3K/AKT signaling cascade (By similarity).

Interacts with APPL1 and APPL2 (By similarity).

Interacts with SRC (By similarity).

Interacts with ALOX5; this interaction bridges ALOX5 with CD40 after CD40 ligation in B cells and leads to the production of reactive oxygen species (ROS) (By similarity).

By similarityCurated2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
247545, 10 interactors

Database of interacting proteins

More...
DIPi
DIP-33696N

Protein interaction database and analysis system

More...
IntActi
Q63787, 18 interactors

Molecular INTeraction database

More...
MINTi
Q63787

STRING: functional protein association networks

More...
STRINGi
10116.ENSRNOP00000025687

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1724
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Biological Magnetic Resonance Data Bank

More...
BMRBi
Q63787

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q63787

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q63787

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini3 – 79SH3PROSITE-ProRule annotationAdd BLAST77
Domaini113 – 301Rho-GAPPROSITE-ProRule annotationAdd BLAST189
Domaini333 – 428SH2 1PROSITE-ProRule annotationAdd BLAST96
Domaini624 – 718SH2 2PROSITE-ProRule annotationAdd BLAST95

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The SH3 domain mediates the binding to CBLB.By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the PI3K p85 subunit family.Curated

Keywords - Domaini

Repeat, SH2 domain, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4637, Eukaryota

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q63787

KEGG Orthology (KO)

More...
KOi
K02649

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q63787

Family and domain databases

Conserved Domains Database

More...
CDDi
cd09930, SH2_cSH2_p85_like, 1 hit
cd09942, SH2_nSH2_p85_like, 1 hit
cd11910, SH3_PI3K_p85alpha, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.555.10, 1 hit
3.30.505.10, 2 hits

Intrinsically Disordered proteins with Extensive Annotations and Literature

More...
IDEALi
IID50255

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR032498, PI3K_P85_iSH2
IPR035591, PI3K_p85alpha_SH3
IPR035020, PI3kinase_P85_cSH2
IPR035022, PI3kinase_P85_nSH2
IPR008936, Rho_GTPase_activation_prot
IPR000198, RhoGAP_dom
IPR000980, SH2
IPR036860, SH2_dom_sf
IPR036028, SH3-like_dom_sf
IPR001452, SH3_domain

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF16454, PI3K_P85_iSH2, 1 hit
PF00620, RhoGAP, 1 hit
PF00017, SH2, 2 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00401, SH2DOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00324, RhoGAP, 1 hit
SM00252, SH2, 2 hits
SM00326, SH3, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48350, SSF48350, 1 hit
SSF50044, SSF50044, 1 hit
SSF55550, SSF55550, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50238, RHOGAP, 1 hit
PS50001, SH2, 2 hits
PS50002, SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform p85-alpha (identifier: Q63787-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSAEGYQYRA LYDYKKEREE DIDLHLGDIL TVNKGSLVAL GFSDGQEARP
60 70 80 90 100
EDIGWLNGYN ETTGERGDFP GTYVEYIGRK RISPPTPKPR PPRPLPVAPG
110 120 130 140 150
SSKTEADTEQ PVLTLPDLAE QFAPPDVAPP LLIKLLEAIE KKGLECSTLY
160 170 180 190 200
RTQSSSNPAE LRQLLDCDPP SVDLDVFDEH VLADAFKRYL ADLPNPVIPV
210 220 230 240 250
AVYNEMMSLA QEVPSSEDYI QLLKKLIRSP NIPHQYWLTL QYLLKHFFKL
260 270 280 290 300
SQASSKNLLN ARALSEIFSH VLFRFPAASS DNTEHLIKAV ELLISAEWSE
310 320 330 340 350
RQPAPALPPK PPKPTSIANN SMNNNMSLQD AEWYWGDISR EEVNEKLRDT
360 370 380 390 400
ADGTFLVRDA STKMHGDYTL TLRKGGNNKL IKIFHRDGKY GFSDPLTFNS
410 420 430 440 450
VVELINHYRN ESLAQYNPKL DVKLLYPVSK YQQDQVVKED NIEAVGKKLH
460 470 480 490 500
EYNTQFQEKS REYDRLYEEY TRTSQEIQMK RTAIEAFNDT IKIFEEQCHP
510 520 530 540 550
QERYSKDYIE KFKREGNEKE IQRIMHNHDK LKSRISEIID SRRRLEEDLK
560 570 580 590 600
KQAAEYREID KRMNSIKPDL IQLRKTRDQY LMWLTQKGVR QKKLNEWLGN
610 620 630 640 650
ENTEDQYSLV DDDEDLPHHD EKTWNVGSSN RNKAENLLRG KRDGTFLVRE
660 670 680 690 700
SSKQGCYACS VVVDGEVKHC VINKTATGYG FAEPYNLYSS LKELVLHYQH
710 720
TSLVQHNDSL NVTLAYPVYA QQRR
Length:724
Mass (Da):83,531
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i95C65CF612873B84
GO
Isoform p55-alpha (identifier: Q63787-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-270: Missing.
     271-304: VLFRFPAASSDNTEHLIKAVELLISAEWSERQPA → MYTTVWTMEDLDLECAKTDINCGTDLMFYIEMDP

Show »
Length:454
Mass (Da):53,394
Checksum:i6F578AB47105FC38
GO
Isoform p50-alpha (identifier: Q63787-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-300: Missing.
     301-306: RQPAPA → MHNLQT

Show »
Length:424
Mass (Da):49,959
Checksum:iC2E52B0D385D99E9
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F1LNG5F1LNG5_RAT
Phosphatidylinositol 3-kinase 85 kD...
Pik3r1 rCG_44396
724Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0RC47M0RC47_RAT
Phosphatidylinositol 3-kinase regul...
Pik3r1 rCG_44396
454Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0047111 – 300Missing in isoform p50-alpha. 2 PublicationsAdd BLAST300
Alternative sequenceiVSP_0047091 – 270Missing in isoform p55-alpha. 1 PublicationAdd BLAST270
Alternative sequenceiVSP_004710271 – 304VLFRF…ERQPA → MYTTVWTMEDLDLECAKTDI NCGTDLMFYIEMDP in isoform p55-alpha. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_004712301 – 306RQPAPA → MHNLQT in isoform p50-alpha. 2 Publications6

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D64045 mRNA Translation: BAA18932.1
D64048 mRNA Translation: BAA18933.1
U50412 mRNA Translation: AAC52846.1
D78486 mRNA Translation: BAA24426.1

NCBI Reference Sequences

More...
RefSeqi
NP_037137.1, NM_013005.1 [Q63787-1]

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
25513

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
rno:25513

UCSC genome browser

More...
UCSCi
RGD:3329, rat [Q63787-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D64045 mRNA Translation: BAA18932.1
D64048 mRNA Translation: BAA18933.1
U50412 mRNA Translation: AAC52846.1
D78486 mRNA Translation: BAA24426.1
RefSeqiNP_037137.1, NM_013005.1 [Q63787-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1FU5NMR-A322-431[»]
1FU6NMR-A322-431[»]
BMRBiQ63787
SMRiQ63787
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi247545, 10 interactors
DIPiDIP-33696N
IntActiQ63787, 18 interactors
MINTiQ63787
STRINGi10116.ENSRNOP00000025687

PTM databases

iPTMnetiQ63787
PhosphoSitePlusiQ63787

Proteomic databases

jPOSTiQ63787
PaxDbiQ63787
PRIDEiQ63787

Genome annotation databases

GeneIDi25513
KEGGirno:25513
UCSCiRGD:3329, rat [Q63787-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5295
RGDi3329, Pik3r1

Phylogenomic databases

eggNOGiKOG4637, Eukaryota
InParanoidiQ63787
KOiK02649
PhylomeDBiQ63787

Enzyme and pathway databases

ReactomeiR-RNO-109704, PI3K Cascade
R-RNO-112399, IRS-mediated signalling
R-RNO-114604, GPVI-mediated activation cascade
R-RNO-1250342, PI3K events in ERBB4 signaling
R-RNO-1257604, PIP3 activates AKT signaling
R-RNO-1266695, Interleukin-7 signaling
R-RNO-1433557, Signaling by SCF-KIT
R-RNO-1660499, Synthesis of PIPs at the plasma membrane
R-RNO-180292, GAB1 signalosome
R-RNO-186763, Downstream signal transduction
R-RNO-1963642, PI3K events in ERBB2 signaling
R-RNO-198203, PI3K/AKT activation
R-RNO-202424, Downstream TCR signaling
R-RNO-2029485, Role of phospholipids in phagocytosis
R-RNO-210993, Tie2 Signaling
R-RNO-2424491, DAP12 signaling
R-RNO-2730905, Role of LAT2/NTAL/LAB on calcium mobilization
R-RNO-388841, Costimulation by the CD28 family
R-RNO-389357, CD28 dependent PI3K/Akt signaling
R-RNO-416476, G alpha (q) signalling events
R-RNO-430116, GP1b-IX-V activation signalling
R-RNO-4420097, VEGFA-VEGFR2 Pathway
R-RNO-512988, Interleukin-3, Interleukin-5 and GM-CSF signaling
R-RNO-5654689, PI-3K cascade:FGFR1
R-RNO-5654695, PI-3K cascade:FGFR2
R-RNO-5654710, PI-3K cascade:FGFR3
R-RNO-5654720, PI-3K cascade:FGFR4
R-RNO-6811558, PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
R-RNO-8851907, MET activates PI3K/AKT signaling
R-RNO-8853659, RET signaling
R-RNO-9009391, Extra-nuclear estrogen signaling
R-RNO-9027276, Erythropoietin activates Phosphoinositide-3-kinase (PI3K)
R-RNO-912526, Interleukin receptor SHC signaling
R-RNO-912631, Regulation of signaling by CBL
R-RNO-983695, Antigen activates B Cell Receptor (BCR) leading to generation of second messengers

Miscellaneous databases

EvolutionaryTraceiQ63787

Protein Ontology

More...
PROi
PR:Q63787

Family and domain databases

CDDicd09930, SH2_cSH2_p85_like, 1 hit
cd09942, SH2_nSH2_p85_like, 1 hit
cd11910, SH3_PI3K_p85alpha, 1 hit
Gene3Di1.10.555.10, 1 hit
3.30.505.10, 2 hits
IDEALiIID50255
InterProiView protein in InterPro
IPR032498, PI3K_P85_iSH2
IPR035591, PI3K_p85alpha_SH3
IPR035020, PI3kinase_P85_cSH2
IPR035022, PI3kinase_P85_nSH2
IPR008936, Rho_GTPase_activation_prot
IPR000198, RhoGAP_dom
IPR000980, SH2
IPR036860, SH2_dom_sf
IPR036028, SH3-like_dom_sf
IPR001452, SH3_domain
PfamiView protein in Pfam
PF16454, PI3K_P85_iSH2, 1 hit
PF00620, RhoGAP, 1 hit
PF00017, SH2, 2 hits
PRINTSiPR00401, SH2DOMAIN
SMARTiView protein in SMART
SM00324, RhoGAP, 1 hit
SM00252, SH2, 2 hits
SM00326, SH3, 1 hit
SUPFAMiSSF48350, SSF48350, 1 hit
SSF50044, SSF50044, 1 hit
SSF55550, SSF55550, 2 hits
PROSITEiView protein in PROSITE
PS50238, RHOGAP, 1 hit
PS50001, SH2, 2 hits
PS50002, SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiP85A_RAT
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q63787
Secondary accession number(s): O55085, P70544, Q63790
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: November 1, 1996
Last modified: October 7, 2020
This is version 181 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again