Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Solute carrier family 12 member 5

Gene

Slc12a5

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Mediates electroneutral potassium-chloride cotransport in mature neurons and is required for neuronal Cl- homeostasis. As major extruder of intracellular chloride, it establishes the low neuronal Cl- levels required for chloride influx after binding of GABA-A and glycine to their receptors, with subsequent hyperpolarization and neuronal inhibition (PubMed:9930699). Involved in the regulation of dendritic spine formation and maturation (PubMed:22345354).2 Publications

Activity regulationi

Inhibited by WNK3.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processIon transport, Potassium transport, Symport, Transport
LigandChloride, Potassium

Protein family/group databases

TCDBi2.A.30.1.14 the cation-chloride cotransporter (ccc) family

Names & Taxonomyi

Protein namesi
Recommended name:
Solute carrier family 12 member 5
Alternative name(s):
Electroneutral potassium-chloride cotransporter 2
Furosemide-sensitive K-Cl cotransporter
K-Cl cotransporter 2
Short name:
rKCC2
Neuronal K-Cl cotransporter
Gene namesi
Name:Slc12a5
Synonyms:Kcc2
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi620811 Slc12a5

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 133CytoplasmicSequence analysisAdd BLAST133
Transmembranei134 – 154HelicalSequence analysisAdd BLAST21
Transmembranei156 – 176HelicalSequence analysisAdd BLAST21
Topological domaini177 – 194CytoplasmicSequence analysisAdd BLAST18
Transmembranei195 – 215HelicalSequence analysisAdd BLAST21
Transmembranei217 – 237HelicalSequence analysisAdd BLAST21
Topological domaini238 – 254CytoplasmicSequence analysisAdd BLAST17
Transmembranei255 – 275HelicalSequence analysisAdd BLAST21
Transmembranei278 – 298HelicalSequence analysisAdd BLAST21
Topological domaini299 – 418CytoplasmicSequence analysisAdd BLAST120
Transmembranei419 – 439HelicalSequence analysisAdd BLAST21
Transmembranei459 – 479HelicalSequence analysisAdd BLAST21
Topological domaini480 – 496CytoplasmicSequence analysisAdd BLAST17
Transmembranei497 – 517HelicalSequence analysisAdd BLAST21
Transmembranei570 – 590HelicalSequence analysisAdd BLAST21
Topological domaini591 – 630CytoplasmicSequence analysisAdd BLAST40
Transmembranei631 – 651HelicalSequence analysisAdd BLAST21
Transmembranei848 – 868HelicalSequence analysisAdd BLAST21
Topological domaini869 – 1139CytoplasmicSequence analysisAdd BLAST271

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Chemistry databases

ChEMBLiCHEMBL1075108

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001780361 – 1139Solute carrier family 12 member 5Add BLAST1139

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei57PhosphothreonineCombined sources1
Glycosylationi442N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi833N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei1045PhosphoserineCombined sources1
Modified residuei1048PhosphoserineCombined sources1
Modified residuei1049PhosphoserineCombined sources1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ63633
PRIDEiQ63633

PTM databases

iPTMnetiQ63633
PhosphoSitePlusiQ63633

Expressioni

Tissue specificityi

Highly expressed in brain. Not detected in other tissues. Highly expressed in pyramidal neurons and in neurons throughout the cortex, hippocampus, the granular layer of the cerebellum and in groups of neurons throughout the brainstem. Barely detectable in dorsal-root ganglions.

Developmental stagei

Detected in thalamus, but not in hippocampus and neocortex at E20. At birth barely detectable in hippocampus. Expression increases steeply from day 5 to day 9 and then stabilizes at adult levels.

Interactioni

Subunit structurei

Homomultimer and heteromultimer with other K-Cl cotransporters. Interacts with AP2A1 (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
Mycbp2Q7TPH64EBI-1811510,EBI-1811542From Mus musculus.

Protein-protein interaction databases

BioGridi251211, 2 interactors
ELMiQ63633
IntActiQ63633, 1 interactor
STRINGi10116.ENSRNOP00000062103

Chemistry databases

BindingDBiQ63633

Family & Domainsi

Sequence similaritiesi

Belongs to the SLC12A transporter family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2082 Eukaryota
COG0531 LUCA
HOGENOMiHOG000092644
HOVERGENiHBG052852
InParanoidiQ63633
KOiK14427
PhylomeDBiQ63633

Family and domain databases

InterProiView protein in InterPro
IPR004841 AA-permease/SLC12A_dom
IPR030358 KCC2
IPR000076 KCL_cotranspt
IPR018491 SLC12_C
IPR004842 SLC12A_fam
PANTHERiPTHR11827:SF54 PTHR11827:SF54, 1 hit
PfamiView protein in Pfam
PF00324 AA_permease, 2 hits
PF03522 SLC12, 3 hits
PRINTSiPR01081 KCLTRNSPORT
TIGRFAMsiTIGR00930 2a30, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q63633-1) [UniParc]FASTAAdd to basket
Also known as: KCC2a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSRRFTVTSL PPAASAASAD PESRRHSVAD PRRLPREDVK GDGNPKESSP
60 70 80 90 100
FINSTDTEKG REYDGRNMAL FEEEMDTSPM VSSLLSGLAN YTNLPQGSKE
110 120 130 140 150
HEEAENNEGG KKKPVQAPRM GTFMGVYLPC LQNIFGVILF LRLTWVVGIA
160 170 180 190 200
GIMESFCMVF ICCSCTMLTA ISMSAIATNG VVPAGGSYYM ISRSLGPEFG
210 220 230 240 250
GAVGLCFYLG TTFAGAMYIL GTIEILLAYL FPAMAIFKAE DASGEAAAML
260 270 280 290 300
NNMRVYGTCV LTCMATVVFV GVKYVNKFAL VFLGCVILSI LAIYAGVIKS
310 320 330 340 350
AFDPPNFPIC LLGNRTLSRH GFDVCAKLAW EGNETVTTRL WGLFCSSRLL
360 370 380 390 400
NATCDEYFTR NNVTEIQGIP GAASGLIKEN LWSSYLTKGV IVERRGMPSV
410 420 430 440 450
GLADGTPVDM DHPYVFSDMT SYFTLLVGIY FPSVTGIMAG SNRSGDLRDA
460 470 480 490 500
QKSIPTGTIL AIATTSAVYI SSVVLFGACI EGVVLRDKFG EAVNGNLVVG
510 520 530 540 550
TLAWPSPWVI VIGSFFSTCG AGLQSLTGAP RLLQAISRDG IVPFLQVFGH
560 570 580 590 600
GKANGEPTWA LLLTACICEI GILIASLDEV APILSMFFLM CYMFVNLACA
610 620 630 640 650
VQTLLRTPNW RPRFRYYHWT LSFLGMSLCL ALMFICSWYY ALVAMLIAGL
660 670 680 690 700
IYKYIEYRGA EKEWGDGIRG LSLSAARYAL LRLEEGPPHT KNWRPQLLVL
710 720 730 740 750
VRVDQDQNVV HPQLLSLTSQ LKAGKGLTIV GSVLEGTFLD NHPQAQRAEE
760 770 780 790 800
SIRRLMEAEK VKGFCQVVIS SNLRDGVSHL IQSGGLGGLQ HNTVLVGWPR
810 820 830 840 850
NWRQKEDHQT WRNFIELVRE TTAGHLALLV TKNVSMFPGN PERFSEGSID
860 870 880 890 900
VWWIVHDGGM LMLLPFLLRH HKVWRKCKMR IFTVAQMDDN SIQMKKDLTT
910 920 930 940 950
FLYHLRITAE VEVVEMHESD ISAYTYEKTL VMEQRSQILK QMHLTKNERE
960 970 980 990 1000
REIQSITDES RGSIRRKNPA NTRLRLNVPE ETACDNEEKP EEEVQLIHDQ
1010 1020 1030 1040 1050
SAPSCPSSSP SPGEEPEGEG ETDPEKVHLT WTKDKSAAQK NKGPSPVSSE
1060 1070 1080 1090 1100
GIKDFFSMKP EWENLNQSNV RRMHTAVRLN EVIVNKSRDA KLVLLNMPGP
1110 1120 1130
PRNRNGDENY MEFLEVLTEQ LDRVMLVRGG GREVITIYS
Length:1,139
Mass (Da):126,247
Last modified:December 4, 2007 - v2
Checksum:i79748F3813EBEFA0
GO
Isoform 2 (identifier: Q63633-2) [UniParc]FASTAAdd to basket
Also known as: KCC2b

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MSRRFTVTSLPPAASAASADPESRRHSVADPRRLPREDVK → MLNNLTDCEDGDGGANP

Show »
Length:1,116
Mass (Da):123,563
Checksum:i8E2FDACDD7FDE2F6
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F1LNP4F1LNP4_RAT
Solute carrier family 12 member 5
Slc12a5
1,139Annotation score:
D3ZGI9D3ZGI9_RAT
Solute carrier family 12 member 5
Slc12a5
1,116Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0299111 – 40MSRRF…REDVK → MLNNLTDCEDGDGGANP in isoform 2. 1 PublicationAdd BLAST40

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U55816 mRNA Translation: AAC52635.1
EF641113 mRNA Translation: ABV03586.1
PIRiT31432
RefSeqiNP_599190.1, NM_134363.1 [Q63633-2]
UniGeneiRn.10513

Genome annotation databases

GeneIDi171373
KEGGirno:171373

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U55816 mRNA Translation: AAC52635.1
EF641113 mRNA Translation: ABV03586.1
PIRiT31432
RefSeqiNP_599190.1, NM_134363.1 [Q63633-2]
UniGeneiRn.10513

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi251211, 2 interactors
ELMiQ63633
IntActiQ63633, 1 interactor
STRINGi10116.ENSRNOP00000062103

Chemistry databases

BindingDBiQ63633
ChEMBLiCHEMBL1075108

Protein family/group databases

TCDBi2.A.30.1.14 the cation-chloride cotransporter (ccc) family

PTM databases

iPTMnetiQ63633
PhosphoSitePlusiQ63633

Proteomic databases

PaxDbiQ63633
PRIDEiQ63633

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi171373
KEGGirno:171373

Organism-specific databases

CTDi57468
RGDi620811 Slc12a5

Phylogenomic databases

eggNOGiKOG2082 Eukaryota
COG0531 LUCA
HOGENOMiHOG000092644
HOVERGENiHBG052852
InParanoidiQ63633
KOiK14427
PhylomeDBiQ63633

Miscellaneous databases

PROiPR:Q63633

Family and domain databases

InterProiView protein in InterPro
IPR004841 AA-permease/SLC12A_dom
IPR030358 KCC2
IPR000076 KCL_cotranspt
IPR018491 SLC12_C
IPR004842 SLC12A_fam
PANTHERiPTHR11827:SF54 PTHR11827:SF54, 1 hit
PfamiView protein in Pfam
PF00324 AA_permease, 2 hits
PF03522 SLC12, 3 hits
PRINTSiPR01081 KCLTRNSPORT
TIGRFAMsiTIGR00930 2a30, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiS12A5_RAT
AccessioniPrimary (citable) accession number: Q63633
Secondary accession number(s): A7Y821
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 13, 2002
Last sequence update: December 4, 2007
Last modified: September 12, 2018
This is version 138 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again