Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 131 (12 Aug 2020)
Sequence version 2 (01 Nov 1998)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Espin

Gene

Espn

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Multifunctional actin-bundling protein. Plays a major role in regulating the organization, dimension, dynamics and signaling capacities of the actin filament-rich microvilli in the mechanosensory and chemosensory cells (PubMed:9763424). Required for the assembly and stabilization of the stereociliary parallel actin bundles. Plays a crucial role in the formation and maintenance of inner ear hair cell stereocilia. Involved in the elongation of actin in stereocilia. In extrastriolar hair cells, required for targeting MYO3B to stereocilia tips, and for regulation of stereocilia diameter and staircase formation (By similarity).By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • actin filament binding Source: UniProtKB
  • SH3 domain binding Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding
Biological processHearing

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Espin
Alternative name(s):
Ectoplasmic specialization protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Espn
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Rat genome database

More...
RGDi
620652, Espn

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Cytoskeleton, Synapse

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003346681 – 837EspinAdd BLAST837

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei337PhosphoserineCombined sources1
Modified residuei341PhosphoserineCombined sources1
Modified residuei400PhosphoserineCombined sources1
Modified residuei401PhosphoserineCombined sources1
Modified residuei497PhosphoserineCombined sources1
Modified residuei504PhosphoserineCombined sources1
Modified residuei531PhosphoserineCombined sources1
Modified residuei631PhosphoserineBy similarity1
Modified residuei670PhosphoserineCombined sources1
Modified residuei674PhosphoserineCombined sources1
Modified residuei680PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q63618

PRoteomics IDEntifications database

More...
PRIDEi
Q63618

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q63618

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q63618

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed at high concentration in the microvillar parallel actin bundle (PAB) of hair cells stereocilia in the cochlea and vestibular system. Detected also at high levels of a number of other sensory cell types, including taste receptor cells, solitary chemoreceptor cells, vomeronasal sensory neurons and Merkel cells. Isoform 1 is detected in testis. Isoforms 2 is detected in small intestine and kidney (at protein level). Isoforms 3, 4, 6 and 8 are expressed in Purkinje cells dendritic spines.4 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Isoform 2 accumulates in the brush border during enterocyte differentiation and migration along the crypt-villus axis in adults.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSRNOG00000010270, Expressed in jejunum and 20 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q63618, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q63618, RN

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer (By similarity).

Interacts with PFN2 (By similarity). Binds F-actin in a Ca2+-resistant fashion (PubMed:8799813, PubMed:9763424).

Interacts (via N-terminal) with BAIAP2 (via SH3-domain) (PubMed:12598619).

Interacts with MYO3A (via C-terminus).

Interacts with MYO3B (via C-terminus) (By similarity).

By similarity3 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
248563, 2 interactors

Molecular INTeraction database

More...
MINTi
Q63618

STRING: functional protein association networks

More...
STRINGi
10116.ENSRNOP00000039445

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q63618

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati1 – 31ANK 1Add BLAST31
Repeati35 – 66ANK 2Add BLAST32
Repeati69 – 99ANK 3Add BLAST31
Repeati103 – 132ANK 4Add BLAST30
Repeati137 – 167ANK 5Add BLAST31
Repeati171 – 201ANK 6Add BLAST31
Repeati205 – 235ANK 7Add BLAST31
Repeati238 – 267ANK 8Add BLAST30
Repeati270 – 299ANK 9Add BLAST30
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini635 – 652WH2PROSITE-ProRule annotationAdd BLAST18

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili738 – 814Sequence analysisAdd BLAST77

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi412 – 455Pro-richAdd BLAST44
Compositional biasi582 – 604Pro-richAdd BLAST23
Compositional biasi617 – 620Poly-Ser4

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The WH2-domain binds actin monomer and mediated actin bundle assembly.By similarity

Keywords - Domaini

ANK repeat, Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0504, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160408

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_086871_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q63618

Database of Orthologous Groups

More...
OrthoDBi
347029at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q63618

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002110, Ankyrin_rpt
IPR020683, Ankyrin_rpt-contain_dom
IPR036770, Ankyrin_rpt-contain_sf
IPR030233, Espn
IPR003124, WH2_dom

The PANTHER Classification System

More...
PANTHERi
PTHR24153:SF14, PTHR24153:SF14, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12796, Ank_2, 2 hits
PF02205, WH2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00248, ANK, 8 hits
SM00246, WH2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48403, SSF48403, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50297, ANK_REP_REGION, 1 hit
PS50088, ANK_REPEAT, 6 hits
PS51082, WH2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q63618-1) [UniParc]FASTAAdd to basket
Also known as: large

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALEQAMQAA RRGDLDVLRS LHAAGLLGPS LRDPLDALPV HHAARSGKLH
60 70 80 90 100
CLRYLVEEVA LPAVSRARNG ATPAHDAAAT GYLSCLQWLL TQGGCRVQEK
110 120 130 140 150
DNSGATVLHL AARFGHPDVV NWLLYQGGAN SAITTDTGAL PIHYAAAKGD
160 170 180 190 200
LPSMKLLVGH YPEGVNAQTN NGATPLYLAC QEGHLEVTKY LVQECSADPH
210 220 230 240 250
LRAQDGMTPL HAAAQMGHNP VLVWLVSFAD VSFEQDHDGA TAMHFAASRG
260 270 280 290 300
HTKVLSWLLL HGAEISQDLW GGTPLHDAAE NGELECCQIL AVNGAGLDVR
310 320 330 340 350
DHDGYTAADL ADFNGHTHCS RYLRTVQTLS LEHRVLSRDP SMDLEAKQPD
360 370 380 390 400
SGMSSPNTTM SVQPPNFDLG SPTSTLSNYD SCSSSHSSSK GQRSTRGARS
410 420 430 440 450
SDLQSYMDML NPEPRSKQGK PSSLPPPPPP SFPPPPPPGT QLPPPPPGYP
460 470 480 490 500
APNPPVGLHL DNIYMQTKNK LRHVEVDSLK KEPSSGDGYS GLRRQDSGLL
510 520 530 540 550
RQDSELLLRH NTGLRRQDSD RKQRSFSKQP STGDYYRQLG RSPGEPLAAR
560 570 580 590 600
PGMAHSEEAA LLPGNHVHNG CSADSKASRE LPPPPPPPPL PEALSSPPPA
610 620 630 640 650
PPLPIEGAGA ACGQRRSSSS TGSTKSFNMM SPTGDNSELL AEIKAGKSLK
660 670 680 690 700
PTPQSKGLTT VFSGSGQPAS QPESPQPAVS PGPSRARSPT PPASGPQPLL
710 720 730 740 750
NGSIVPAPPA TLAPGVHLDV EALIPTLDEQ GRPIPEWKRQ VMVRKLQQKM
760 770 780 790 800
QEEEEQRRKE EEEEARLASL PAWRRDILRK KLEEEREQKR KEEERQKLEE
810 820 830
IQRAKEQSEK LRTLGYDEAK LAPWQRQVIL KKGEIPK
Length:837
Mass (Da):90,569
Last modified:November 1, 1998 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i64F3C2C23980CA72
GO
Isoform 2 (identifier: Q63618-2) [UniParc]FASTAAdd to basket
Also known as: small

The sequence of this isoform differs from the canonical sequence as follows:
     1-609: Missing.
     610-622: AACGQRRSSSSTG → MNSQGPLRGGRMP
     671-671: Q → QVGTGRVPRPGSQCLPSAQPYRFSRQ

Show »
Length:253
Mass (Da):28,240
Checksum:iDBC40BB6B605F416
GO
Isoform 3 (identifier: Q63618-3) [UniParc]FASTAAdd to basket
Also known as: Purkinje cell espin 1

The sequence of this isoform differs from the canonical sequence as follows:
     1-326: Missing.
     327-329: QTL → MGD

Show »
Length:511
Mass (Da):55,696
Checksum:iFFF7608F1416911E
GO
Isoform 4 (identifier: Q63618-4) [UniParc]FASTAAdd to basket
Also known as: Purkinje cell espin 1+

The sequence of this isoform differs from the canonical sequence as follows:
     1-326: Missing.
     327-329: QTL → MGD
     622-622: G → GKVRILRHRK

Show »
Length:520
Mass (Da):56,883
Checksum:iBBE9BC8762A658F9
GO
Isoform 5 (identifier: Q63618-5) [UniParc]FASTAAdd to basket
Also known as: 3B

The sequence of this isoform differs from the canonical sequence as follows:
     1-522: Missing.
     523-558: QRSFSKQPSTGDYYRQLGRSPGEPLAARPGMAHSEE → MAHSEEVRVHQPAPAGCTGSNPVSHSSLSGPSAPPQ

Show »
Length:315
Mass (Da):33,968
Checksum:i4D6CEBEE8E098D60
GO
Isoform 6 (identifier: Q63618-6) [UniParc]FASTAAdd to basket
Also known as: Purkinje cell espin 2

The sequence of this isoform differs from the canonical sequence as follows:
     1-326: Missing.
     327-329: QTL → MGD
     483-558: Missing.

Show »
Length:435
Mass (Da):47,198
Checksum:i2A9718BE8E574536
GO
Isoform 7 (identifier: Q63618-7) [UniParc]FASTAAdd to basket
Also known as: 3A

The sequence of this isoform differs from the canonical sequence as follows:
     1-552: Missing.

Show »
Length:285
Mass (Da):31,063
Checksum:iCE8819F12C00975E
GO
Isoform 8 (identifier: Q63618-8) [UniParc]FASTAAdd to basket
Also known as: Purkinje cell espin 2+

The sequence of this isoform differs from the canonical sequence as follows:
     1-326: Missing.
     327-329: QTL → MGD
     483-558: Missing.
     622-622: G → GKVRILRHRK

Show »
Length:444
Mass (Da):48,386
Checksum:i2DC996CBCEDBD5E0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F1LQ34F1LQ34_RAT
Espin
Espn
838Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0337411 – 609Missing in isoform 2. 1 PublicationAdd BLAST609
Alternative sequenceiVSP_0337421 – 552Missing in isoform 7. 1 PublicationAdd BLAST552
Alternative sequenceiVSP_0337431 – 522Missing in isoform 5. 1 PublicationAdd BLAST522
Alternative sequenceiVSP_0337441 – 326Missing in isoform 3, isoform 4, isoform 6 and isoform 8. 1 PublicationAdd BLAST326
Alternative sequenceiVSP_033745327 – 329QTL → MGD in isoform 3, isoform 4, isoform 6 and isoform 8. 1 Publication3
Alternative sequenceiVSP_033746483 – 558Missing in isoform 6 and isoform 8. 1 PublicationAdd BLAST76
Alternative sequenceiVSP_033747523 – 558QRSFS…AHSEE → MAHSEEVRVHQPAPAGCTGS NPVSHSSLSGPSAPPQ in isoform 5. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_033748610 – 622AACGQ…SSSTG → MNSQGPLRGGRMP in isoform 2. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_033749622G → GKVRILRHRK in isoform 4 and isoform 8. 1 Publication1
Alternative sequenceiVSP_033750671Q → QVGTGRVPRPGSQCLPSAQP YRFSRQ in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U46007 mRNA Translation: AAC53594.1
AF076856 mRNA Translation: AAC69563.1
AF540946 mRNA Translation: AAO50330.1
AF540947 mRNA Translation: AAO50331.1
AF540948 mRNA Translation: AAO50332.1
AF540949 mRNA Translation: AAO50333.1
AY587568 mRNA Translation: AAT46470.1
AY587569 mRNA Translation: AAT46471.1

NCBI Reference Sequences

More...
RefSeqi
XP_006239546.1, XM_006239484.3 [Q63618-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSRNOT00000013646; ENSRNOP00000013645; ENSRNOG00000010270 [Q63618-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
56227

UCSC genome browser

More...
UCSCi
RGD:620652, rat [Q63618-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U46007 mRNA Translation: AAC53594.1
AF076856 mRNA Translation: AAC69563.1
AF540946 mRNA Translation: AAO50330.1
AF540947 mRNA Translation: AAO50331.1
AF540948 mRNA Translation: AAO50332.1
AF540949 mRNA Translation: AAO50333.1
AY587568 mRNA Translation: AAT46470.1
AY587569 mRNA Translation: AAT46471.1
RefSeqiXP_006239546.1, XM_006239484.3 [Q63618-2]

3D structure databases

SMRiQ63618
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi248563, 2 interactors
MINTiQ63618
STRINGi10116.ENSRNOP00000039445

PTM databases

iPTMnetiQ63618
PhosphoSitePlusiQ63618

Proteomic databases

PaxDbiQ63618
PRIDEiQ63618

Genome annotation databases

EnsembliENSRNOT00000013646; ENSRNOP00000013645; ENSRNOG00000010270 [Q63618-2]
GeneIDi56227
UCSCiRGD:620652, rat [Q63618-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
83715
RGDi620652, Espn

Phylogenomic databases

eggNOGiKOG0504, Eukaryota
GeneTreeiENSGT00940000160408
HOGENOMiCLU_086871_0_0_1
InParanoidiQ63618
OrthoDBi347029at2759
PhylomeDBiQ63618

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q63618

Gene expression databases

BgeeiENSRNOG00000010270, Expressed in jejunum and 20 other tissues
ExpressionAtlasiQ63618, baseline and differential
GenevisibleiQ63618, RN

Family and domain databases

Gene3Di1.25.40.20, 1 hit
InterProiView protein in InterPro
IPR002110, Ankyrin_rpt
IPR020683, Ankyrin_rpt-contain_dom
IPR036770, Ankyrin_rpt-contain_sf
IPR030233, Espn
IPR003124, WH2_dom
PANTHERiPTHR24153:SF14, PTHR24153:SF14, 1 hit
PfamiView protein in Pfam
PF12796, Ank_2, 2 hits
PF02205, WH2, 1 hit
SMARTiView protein in SMART
SM00248, ANK, 8 hits
SM00246, WH2, 1 hit
SUPFAMiSSF48403, SSF48403, 1 hit
PROSITEiView protein in PROSITE
PS50297, ANK_REP_REGION, 1 hit
PS50088, ANK_REPEAT, 6 hits
PS51082, WH2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiESPN_RAT
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q63618
Secondary accession number(s): Q6GYS2
, Q6GYS3, Q80ZB6, Q80ZB7, Q80ZB8, Q80ZB9, Q9Z2B4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: November 1, 1998
Last modified: August 12, 2020
This is version 131 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again