Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 105 (16 Oct 2019)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Microtubule-associated protein 6

Gene

Map6

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in microtubule stabilization in many cell types, including neuronal cells (PubMed:8700896, PubMed:9660871, PubMed:3456161, PubMed:11413126, PubMed:28521134). Specifically has microtubule cold stabilizing activity (PubMed:3456161). Involved in dendrite morphogenesis and maintenance by regulating lysosomal trafficking via its interaction with TMEM106B (By similarity). Regulates KIF5A-mediated axonal cargo transport (PubMed:28521134). Regulates axonal growth during neuron polarization (PubMed:28521134).By similarity5 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • calmodulin binding Source: UniProtKB-KW
  • microtubule binding Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalmodulin-binding
Biological processTransport

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Microtubule-associated protein 6
Short name:
MAP-6
Alternative name(s):
145-kDa STOP
Short name:
STOP145
Stable tubule-only polypeptide
Short name:
STOP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Map6
Synonyms:Mtap6
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Rat genome database

More...
RGDi
61804 Map6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Golgi apparatus, Membrane, Microtubule

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi5C → G: Loss of palmitoylation. Loss of Golgi and secretory vesicle localization; when associated with G-10 and G-11. Loss of axonal polarization; when associated with G-10 and G-11. Increased dendrite localization without affecting association with microtubules; when associated with G-10 and G-11. 1 Publication1
Mutagenesisi10 – 11CC → GG: Loss of Golgi and secretory vesicle localization; when associated with G-5. Loss of axonal polarization; when associated with G-5. Increased dendrite localization without affecting association with microtubules; when associated with G-5. 1 Publication2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003440461 – 952Microtubule-associated protein 6Add BLAST952

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi5S-palmitoyl cysteine1 Publication1
Lipidationi10S-palmitoyl cysteine1 Publication1
Lipidationi11S-palmitoyl cysteine1 Publication1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei98PhosphoserineBy similarity1
Modified residuei141PhosphotyrosineBy similarity1
Modified residuei185PhosphoserineCombined sources1
Modified residuei207PhosphoserineBy similarity1
Modified residuei590PhosphoserineCombined sources1
Modified residuei681PhosphoserineCombined sources1
Modified residuei736PhosphoserineCombined sources1
Modified residuei951PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Palmitoylated. Probably depalmitoylated by ABHD17A, ABHD17B and ABHD17C. During neuronal polarization, palmitoylation and depalmitoylation cycles regulate MAP6 shuttling between secretory vesicles and microtubules, and its polarized distribution in the axon.1 Publication

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q63560

PRoteomics IDEntifications database

More...
PRIDEi
Q63560

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q63560

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q63560

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q63560

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is specifically expressed in adult brain. Isoform 2 is predominantly expressed in embryonic brain; expression persists at low levels in the adult brain.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

At E17.5, expressed in brain including hippocampus and corpus callosum (PubMed:28521134). Isoform 1: Expression begins after birth at P1-P5 stages and is maintained in adults (PubMed:9660871, PubMed:28521134). Expressed in mature neurons (PubMed:28521134). Isoform 2: Expressed at E13, E16 and E18 stages (PubMed:9660871, PubMed:28521134). Expression is increased at P1-P5 stages and persists at low levels in the adult brain (PubMed:9660871, PubMed:28521134). Expressed in unpolarized hippocampal neurons and throughout neuronal development (PubMed:28521134).2 Publications

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with calmodulin (via C-terminus); the interaction is dependent on Ca2+ (PubMed:8700896, PubMed:11413126).

Interacts with TMEM106B (By similarity).

Interacts with ZDHHC13 (via ANK repeats) (By similarity).

Interacts with ZDHHC17 (via ANK repeats) (By similarity).

By similarity2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
Tmem106bQ6AYA56EBI-1638469,EBI-9316198

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
248100, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q63560, 3 interactors

Molecular INTeraction database

More...
MINTi
Q63560

STRING: functional protein association networks

More...
STRINGi
10116.ENSRNOP00000032018

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati222 – 267Mc-11 PublicationAdd BLAST46
Repeati268 – 313Mc-21 PublicationAdd BLAST46
Repeati314 – 359Mc-31 PublicationAdd BLAST46
Repeati360 – 405Mc-41 PublicationAdd BLAST46
Repeati406 – 451Mc-51 PublicationAdd BLAST46

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 15Calmodulin-binding1 PublicationAdd BLAST15
Regioni116 – 139Mn 11 PublicationAdd BLAST24
Regioni124 – 138Calmodulin-binding1 PublicationAdd BLAST15
Regioni151 – 174Mn 21 PublicationAdd BLAST24
Regioni160 – 174Calmodulin-binding1 PublicationAdd BLAST15
Regioni187 – 201Calmodulin-binding1 PublicationAdd BLAST15
Regioni222 – 4515 X approximate tandem repeat Mc1 PublicationAdd BLAST230
Regioni235 – 249Calmodulin-binding1 PublicationAdd BLAST15
Regioni280 – 294Calmodulin-binding1 PublicationAdd BLAST15
Regioni325 – 339Calmodulin-binding1 PublicationAdd BLAST15
Regioni373 – 387Calmodulin-binding1 PublicationAdd BLAST15
Regioni421 – 435Calmodulin-binding1 PublicationAdd BLAST15
Regioni473 – 496Mn 31 PublicationAdd BLAST24
Regioni481 – 495Calmodulin-binding1 PublicationAdd BLAST15
Regioni532 – 546Calmodulin-binding1 PublicationAdd BLAST15
Regioni559 – 573Calmodulin-binding1 PublicationAdd BLAST15

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the STOP family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IIA0 Eukaryota
ENOG4110KV2 LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000113479

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q63560

KEGG Orthology (KO)

More...
KOi
K10432

Database of Orthologous Groups

More...
OrthoDBi
577082at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q63560

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007882 MAP6

The PANTHER Classification System

More...
PANTHERi
PTHR14759 PTHR14759, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q63560-1) [UniParc]FASTAAdd to basket
Also known as: N-STOP, Neuronal STOP

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAWPCITRAC CIARFWNQLD KADIAVPLVF TKYSEATEHP GAPPQPPAPP
60 70 80 90 100
QPGLAPPSRA VAIETQPAQG ESDAVARATG PAPGPSGDRE TAAAPGRSGL
110 120 130 140 150
GLGAASGSTS GSGPADSVMR QDYRAWKVQR PEPSCRPRSE YQPSDAPFER
160 170 180 190 200
ETQYQKDFRA WPLPRRGDHP WIPKPVQIPA TSQPSPPVLG MPKRRPQSQE
210 220 230 240 250
RGPIQLSADA RDPEGAGGAG VPAAGKASGA DQRDTRRKAG PAWMVTRTEG
260 270 280 290 300
HEEKPLPPAQ SQTQEGGPAA GKASGADQRD TRRKAGPAWM VTRTEGHEEK
310 320 330 340 350
PLPPAQSQTQ EGGPAAGKAS GADQRDTRRK AGPAWMVTRT EGHEETPLPP
360 370 380 390 400
AQSQTQEGGP AAGKASGADQ RDTRRKAGPA WMVTRTEGHE ETPLPPAQSQ
410 420 430 440 450
TQEGGPAAGK ASGADERDTR RKAGPAWMVR RSEGHEQTTA AHAQGTGPEG
460 470 480 490 500
GKGRAVADAL NRQIREEVTS TVSSSYRNEF RAWTDIKPVK PIKAKPQYKP
510 520 530 540 550
PDDKMVHETS YSAQFKGEAS KPTTADNKVV DRRRIRSLYS EPFKESPKVE
560 570 580 590 600
KPSVQSSKPK KTSTSQKPLR KAKDKQVASG QAAKKKTTES PSATKPDDKE
610 620 630 640 650
QSKEMNNKLA EAKESRVKPT SDKNQGPVAK EPHKDQGPVA PGLPKGQGPA
660 670 680 690 700
VQEPLKDQGP MVPGLPKDQA PVVPGSLKGQ SPTAPGPPKD QGAVLLGPMK
710 720 730 740 750
DLGPVAPASV KDQDHMASEL LKNKDSVPLA PAKAQSPLLP EPLKNQSPVV
760 770 780 790 800
PARAKDQSFP APAPTPLKDP GPVIPEPEKD GAPMVPERRK DQNASIMASL
810 820 830 840 850
KNEAPVASES VKNQGLGGPE PAKDTGTDLK GHGSVFVAPV KSQGPVVPEP
860 870 880 890 900
TKGQDPIIPA LAKDQGPILP EPPKNQGPPV VLGPIKNQDP VIPVPLKGQD
910 920 930 940 950
PVVPAPTKDP GPTAPDPLKS QGPRGPQLPT VSPSPPVMIP TVPHAEYIEG

SP
Length:952
Mass (Da):100,485
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3599A5069096FA73
GO
Isoform 2 (identifier: Q63560-2) [UniParc]FASTAAdd to basket
Also known as: E-STOP, Early STOP

The sequence of this isoform differs from the canonical sequence as follows:
     325-325: R → RDTRRKAGPAWMVTRTEGHEEKPLPPAQSQTQEGGPAAGKASGADQR
     615-952: Missing.

Show »
Length:660
Mass (Da):70,622
Checksum:iBCB5494CC1734875
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F1LQZ9F1LQZ9_RAT
Microtubule-associated protein 6
Map6
952Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH78848 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_034728325R → RDTRRKAGPAWMVTRTEGHE EKPLPPAQSQTQEGGPAAGK ASGADQR in isoform 2. 2 Publications1
Alternative sequenceiVSP_034729615 – 952Missing in isoform 2. 2 PublicationsAdd BLAST338

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X93495 mRNA Translation: CAA63762.1
AJ002556 mRNA Translation: CAA05555.1
BC078848 mRNA Translation: AAH78848.1 Sequence problems.

NCBI Reference Sequences

More...
RefSeqi
NP_058900.1, NM_017204.1 [Q63560-1]

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
29457

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
rno:29457

UCSC genome browser

More...
UCSCi
RGD:61804 rat [Q63560-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X93495 mRNA Translation: CAA63762.1
AJ002556 mRNA Translation: CAA05555.1
BC078848 mRNA Translation: AAH78848.1 Sequence problems.
RefSeqiNP_058900.1, NM_017204.1 [Q63560-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi248100, 3 interactors
IntActiQ63560, 3 interactors
MINTiQ63560
STRINGi10116.ENSRNOP00000032018

PTM databases

iPTMnetiQ63560
PhosphoSitePlusiQ63560
SwissPalmiQ63560

Proteomic databases

PaxDbiQ63560
PRIDEiQ63560

Genome annotation databases

GeneIDi29457
KEGGirno:29457
UCSCiRGD:61804 rat [Q63560-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4135
RGDi61804 Map6

Phylogenomic databases

eggNOGiENOG410IIA0 Eukaryota
ENOG4110KV2 LUCA
HOGENOMiHOG000113479
InParanoidiQ63560
KOiK10432
OrthoDBi577082at2759
PhylomeDBiQ63560

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q63560

Family and domain databases

InterProiView protein in InterPro
IPR007882 MAP6
PANTHERiPTHR14759 PTHR14759, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMAP6_RAT
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q63560
Secondary accession number(s): O88748, Q6AYX8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 22, 2008
Last sequence update: November 1, 1996
Last modified: October 16, 2019
This is version 105 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again