Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 116 (12 Aug 2020)
Sequence version 2 (26 Feb 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Dynein heavy chain 1, axonemal

Gene

Dnah1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Force generating protein of cilia required for sperm flagellum motility. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP. Required in spermatozoa for the formation of the inner dynein arms and biogenesis of the axoneme (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi1787 – 1794ATPSequence analysis8
Nucleotide bindingi2054 – 2061ATPSequence analysis8
Nucleotide bindingi2460 – 2467ATPSequence analysis8
Nucleotide bindingi2819 – 2826ATPSequence analysis8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMotor protein
LigandATP-binding, Nucleotide-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Dynein heavy chain 1, axonemal
Alternative name(s):
Axonemal beta dynein heavy chain 1
Ciliary dynein heavy chain 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Dnah1
Synonyms:Dlp1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Rat genome database

More...
RGDi
621795, Dnah1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Dynein, Flagellum, Microtubule

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003189371 – 4516Dynein heavy chain 1, axonemalAdd BLAST4516

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q63164

PRoteomics IDEntifications database

More...
PRIDEi
Q63164

PTM databases

CarbonylDB database of protein carbonylation sites

More...
CarbonylDBi
Q63164

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q63164

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q63164

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSRNOG00000026914, Expressed in testis and 18 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q63164, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q63164, RN

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Consists of at least two heavy chains and a number of intermediate and light chains.

GO - Molecular functioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10116.ENSRNOP00000059841

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q63164

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 1748StemBy similarityAdd BLAST1748
Regioni1749 – 1956AAA 1By similarityAdd BLAST208
Regioni2016 – 2249AAA 2By similarityAdd BLAST234
Regioni2422 – 2682AAA 3By similarityAdd BLAST261
Regioni2780 – 2972AAA 4By similarityAdd BLAST193
Regioni2987 – 3285StalkBy similarityAdd BLAST299
Regioni3388 – 3618AAA 5By similarityAdd BLAST231
Regioni3831 – 4050AAA 6By similarityAdd BLAST220

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili3293 – 3394Sequence analysisAdd BLAST102

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi1787 – 1794GPAGTGKT motif8
Motifi1837 – 1843CFDEFNR motifBy similarity7

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Dynein heavy chains probably consist of an N-terminal stem (which binds cargo and interacts with other dynein components), and the head or motor domain. The motor contains six tandemly-linked AAA domains in the head, which form a ring. A stalk-like structure (formed by two of the coiled coil domains) protrudes between AAA 4 and AAA 5 and terminates in a microtubule-binding site. A seventh domain may also contribute to this ring; it is not clear whether the N-terminus or the C-terminus forms this extra domain. There are four well-conserved and two non-conserved ATPase sites, one per AAA domain. Probably only one of these (within AAA 1) actually hydrolyzes ATP, the others may serve a regulatory function (By similarity).By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the dynein heavy chain family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3595, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154791

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_000038_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q63164

KEGG Orthology (KO)

More...
KOi
K10408

Identification of Orthologs from Complete Genome Data

More...
OMAi
QTQDFID

Database of Orthologous Groups

More...
OrthoDBi
3185at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q63164

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.8.720, 1 hit
1.20.140.100, 1 hit
3.10.490.20, 1 hit
3.20.180.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR035699, AAA_6
IPR035706, AAA_9
IPR041658, AAA_lid_11
IPR042219, AAA_lid_11_sf
IPR026983, DHC_fam
IPR026975, DNAH1
IPR041589, DNAH3_AAA_lid_1
IPR042228, Dynein_2_C
IPR042222, Dynein_2_N
IPR041466, Dynein_AAA5_ext
IPR041228, Dynein_C
IPR043160, Dynein_C_barrel
IPR024743, Dynein_HC_stalk
IPR024317, Dynein_heavy_chain_D4_dom
IPR004273, Dynein_heavy_D6_P-loop
IPR013602, Dynein_heavy_dom-2
IPR027417, P-loop_NTPase

The PANTHER Classification System

More...
PANTHERi
PTHR10676, PTHR10676, 1 hit
PTHR10676:SF358, PTHR10676:SF358, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12774, AAA_6, 2 hits
PF12780, AAA_8, 1 hit
PF12781, AAA_9, 1 hit
PF17857, AAA_lid_1, 1 hit
PF18198, AAA_lid_11, 1 hit
PF08393, DHC_N2, 1 hit
PF17852, Dynein_AAA_lid, 1 hit
PF18199, Dynein_C, 1 hit
PF03028, Dynein_heavy, 1 hit
PF12777, MT, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540, SSF52540, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q63164-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVTLSISDTL HTPAFVENRH LAITGMPTRK ANNGFPSPDD NNVWGQFWKD
60 70 80 90 100
LQTPLLVVVY VHGAQCQLLL PIENRRVSSG SDKSLKNGME ECDKEEASTS
110 120 130 140 150
SQGPGYCPAN VPENHDLEKM LKESSRNPEK TSPNPELKTP PLPLSDLGQP
160 170 180 190 200
RKSPLAGTDK KYPIMKQRGF YSDILSPGTL DQLGDVCCGP YLSQNLIRQA
210 220 230 240 250
DLDKFTPKGQ CHEHWAAESF VIPEDFQERV EQQSIGTTTR LLTQTDFPLQ
260 270 280 290 300
SYEPKVQVPF QVLPGRCPRK IEIERRKQQY LRLDIEQLLA NEGIDSNKLM
310 320 330 340 350
PRHPDLQQPQ TIEQGRDPLF PIYLPLKVFD NEEFDCRTPT EWLNMGLEPD
360 370 380 390 400
AQYRKPVPGK ALLPTDDALG HVHRAGCKQV SFSKCINTGI SLPEAGKKQS
410 420 430 440 450
VSFTLDSNDR NNLTKLSPVL QCLAIKPWEQ GHVKCTEFQL PRFTGALALS
460 470 480 490 500
RNTRAKRGSQ EASTRDHLDF EDPKSQELDY RWCEVGVLDY DEEKKLYLVQ
510 520 530 540 550
KTDKRGLVRD EMGMPIVNGG VTPEGRPPLL DTQYWVPRIQ LLFCAEDPRV
560 570 580 590 600
FTQRVVQANA LRKNTEALLL YNLYVDCMPT EGQRVINEQS LSKIKQWALS
610 620 630 640 650
TPRMRKGPSV LEHLSSLARE VNLDYERSMN KINFDQIVSS KPETFSFVTL
660 670 680 690 700
PEKEEEKVPN QGLVSVPEYP FREQKEDFTF VSLLTRSEVI TALSKVRAEC
710 720 730 740 750
NKVTSMSLFH SNLSKYSRLE EFEQIQSQTF SQVQMFLKDS WISTLKVAMR
760 770 780 790 800
SSLRDMSKGW YNLYETNWEV YLMSKLRKLM ELIKYMLQDT LRFLVQDSLG
810 820 830 840 850
SFAQFIGDAC CSVLECIDDM DWGEDLINSP YKPRKNPLFI VDLVLDNTGV
860 870 880 890 900
HYSTPLEQFE VILLNLFDKG ILATHAVPQL EKLVMEDIFI SGDPLLESVG
910 920 930 940 950
LHEPLVEELR ANITNAMHKA MIPLQAYAKE YRKTYQTQCP SAEEVREVVI
960 970 980 990 1000
THLKEKEILD NSLPSSIIIG PFYINVDNVK QSLSKKRKAL ATSMLDILAK
1010 1020 1030 1040 1050
NLHNEVDSIC EEFRSISRKI YEKPNSIEEL AELRDWMKGI PEKLVILEVR
1060 1070 1080 1090 1100
QALALAARSL VEPEVGPALE IPFNNPLPSM TRHFLLMQER IVKVMSDYEV
1110 1120 1130 1140 1150
MDEFFYNLTT DDFNDKWAAN NWPTKILGQI DMVRQQHVED EEKFRKIQLM
1160 1170 1180 1190 1200
DQNNFQEKLE GLQLVVAGFS THVEIARAHE IANEVRRVKK QLKDCQQLAM
1210 1220 1230 1240 1250
LYNNRERIFG LPITNYDKLS RMVKEFQPYL DLWTTASDWL RWSESWMNDP
1260 1270 1280 1290 1300
LSAIDAEQLE KNVIESFKTM HKCVKQFKDI PACQDVALDI RARIDEFKPY
1310 1320 1330 1340 1350
IPLIQGLRNP GMRNRHWEVL SNEININVRP KANLTFARCL EMNLQDYIES
1360 1370 1380 1390 1400
ISKVAEVAGK EYAIEQALDK MEKEWASILF NVLPYKETDT YILKSPDEAS
1410 1420 1430 1440 1450
QLLDDHIVMT QSMSFSPYKK PFEQRINSWE TKLKLTQEVL EEWLNCQRSW
1460 1470 1480 1490 1500
LYLEPIFSSE DITRQLPVES KRYQTMERIW RKIMKNAYEN REVINVCSDQ
1510 1520 1530 1540 1550
RLLDSLRDCN KLLDLVQKGL SEYLETKRTA FPRFYFLSDD ELLEILSQTK
1560 1570 1580 1590 1600
DPTAVQPHLR KCFENIARLL FQEDLEITHM YSAEGEEVKL SFSIYPSSNV
1610 1620 1630 1640 1650
EDWLLEVERS MKASVHDIIE MAIKAYPTML RTEWVLSWPG QVTIAGCQTY
1660 1670 1680 1690 1700
WTLEVAQALE ASSISSSLFP QLSKQLSDLV ALVRGKLSRM QRMVLSALIV
1710 1720 1730 1740 1750
IEVHAKDVVS KLIDENVVSV HDFEWISQLR YYWTNNDLYI RAVNAEFIYG
1760 1770 1780 1790 1800
YEYLGNSGRL VITPLTDRCY LTLTGALHLK FGGAPAGPAG TGKTETTKDL
1810 1820 1830 1840 1850
GKALAIQTVV FNCSDQLDFM AMGKFFKGLA SAGAWACFDE FNRIDIEVLS
1860 1870 1880 1890 1900
VVAQQITTIQ KAQQQRSREY IKSLGGAVMC LPFLCVLYVQ ALFRPVAMMV
1910 1920 1930 1940 1950
PDYAMIAEIS LYSFGFNEAN VLAKKITTTF KLSSEQLSSQ DHYDFGMRAV
1960 1970 1980 1990 2000
KTVISAAGNL KRENPTMNEE LICLRAIRDV NVPKFLQEDL KLFSGIVSDL
2010 2020 2030 2040 2050
FPTTKEEETD YGILDQAIRK ACEKNNLKDV EGFLIKCIQL YETTVVRHGL
2060 2070 2080 2090 2100
MLVGPTGSGK SNCYRILAAA MTSLKGKPSI SGGVYEAVNY YVLNPKSITM
2110 2120 2130 2140 2150
GQLYGEFDLL THEWTDGIFP SLIRAGAIAS DTNKKWYMFD GPVDAVWIEN
2160 2170 2180 2190 2200
MNTVLDDNKK LCLSSGEIIK LTEAMTMMFE VQDLAVASPA TVSRCGMVYL
2210 2220 2230 2240 2250
EPSILGLMPF VECWLKHLPS IIKPYEEQFK TLFVKFLESS IAFVRTTVKE
2260 2270 2280 2290 2300
VVASTNSNLT MSLLKLLDCF FKPFLPREGL KKIPSEKLSH IPELIEPWFI
2310 2320 2330 2340 2350
FSLVWSVGAT GDHSSRLNFS QWLKIKMVFE QIKLAFPEEG LVYDYRLDDA
2360 2370 2380 2390 2400
GISSTEDDDE DDEESKQVAT ALPAQEGGMV KPPGLWDLPP RDSGHLEKAT
2410 2420 2430 2440 2450
LTASRSEAVA WVKWMDYSVP FTMMPDTNYC NIIVPTMDTM QMSYLLGMLI
2460 2470 2480 2490 2500
TNHKPVLCIG PTGTGKTLTV SNKLLKNLPL EYISHFLTFS ARTSANQTQD
2510 2520 2530 2540 2550
LIDSKLDKRR KGVFGPPLGR NFIFFIDDLN MPALETYGAQ PPIELLRQWM
2560 2570 2580 2590 2600
DHGGWYDRKI IGAFKNLVDI NFVCAMGPPG GGRNAITPRL TRHFNYLSFI
2610 2620 2630 2640 2650
EMDEVSKKRI FSIILGCWMD GLLGEKSYRE PVPGAPNIVH MTEPLVNATI
2660 2670 2680 2690 2700
SIYAIITSQL LPTPAKSHYT FNLRDLSKVF QGILMAEPAK VEDKVQLLRL
2710 2720 2730 2740 2750
WYHENCRVFR DRLVNEEDRG WFDGLLEMKM EDLGVAFNKV CPFQPILYGD
2760 2770 2780 2790 2800
FMSPGSDVKS YELITSENKM MQVIEEYMED YNQINTAKLK LVLFVDAMSH
2810 2820 2830 2840 2850
ICRISRTLRQ ALGNALLLGV GGSGRSSLTR LASHMAEYEC FQVELSKNYG
2860 2870 2880 2890 2900
MSEWREDVKK ILLKAGMQNL PITFLFSDTQ IKNESFLEDI NNILNSGDIP
2910 2920 2930 2940 2950
NLYSADEQDQ IVNTMRPYIQ EQGLQPTKAN LMAAYTGRVR NNIHMVLCMS
2960 2970 2980 2990 3000
PIGEVFRARL RQFPSLVNCC TIDWFNEWPA EALQSVATRF LHEIPELECS
3010 3020 3030 3040 3050
SEVIEGLIHV CVYIHQSVAK KCVEYLAELA RHNYVTPKSY LELLNIFSIL
3060 3070 3080 3090 3100
IGQKKMELKT AKHRMKSGLD KLLRTSEDVA KMQEELEIMR PLLEEAAKDT
3110 3120 3130 3140 3150
LLTMDQIKVD TAIAEETRKS VQAEEIKANE KASKAQAIAD DAQKDLDEAL
3160 3170 3180 3190 3200
PALDAALASL RNLNKNDVTE VRAMQRPPPG VKLVIEAVCI MKGIKPKKVP
3210 3220 3230 3240 3250
GEKPGSKVDD YWEPGKGLLQ DPGRFLESLF KFDKDNIGEA VIKAIQPYID
3260 3270 3280 3290 3300
NEEFQPAAIA KVSKACTSIC QWVRAMHKYH FVAKAVEPKR QALREAQDDL
3310 3320 3330 3340 3350
EVTQRILEEA KHHLREVEDG ISTLQAKYRE CVTKKEELEM KCEQCEQRLG
3360 3370 3380 3390 3400
RADKSQSPGQ PPGAHPTRLL LQLINGLADE KVRWQDTVEN LENMLDNIFG
3410 3420 3430 3440 3450
DVLVAAGFVA YLGPFTGQYR AALYEYWVNQ LTVYGVPHTS KPTLISTLGN
3460 3470 3480 3490 3500
PVKIRSWQIA GLPNDTLSVE NGVINQFSQR WTHFIDPQGQ ANKWIKNMEK
3510 3520 3530 3540 3550
ESGLDVFKLS DRDFLRSMEN AIRFGKPCLL ENVGEELDPA LEPVLLKQTY
3560 3570 3580 3590 3600
KQQGNTVLKL GDTVIPYHED FRMYITTKLP NPHYSPEVST KLTLINFTLS
3610 3620 3630 3640 3650
PSGLEDQLLG QVVAEERPDL EEAKNQLIIS NAKMRQELKD IEDQILYRLS
3660 3670 3680 3690 3700
SSEGNPVDDV ELIKVLEASK MKAAEIQAKV RIAEQTEKDI DLTRMEYIPV
3710 3720 3730 3740 3750
AVRTQILFFC VSDLANVDPM YQYSLEWFLN IFLSGIANSE RADNLKKRIV
3760 3770 3780 3790 3800
NINRYLTFSL YSNVCRSLFE KHKLMFAFLL CVRIMMNEGK INQGEWRYLL
3810 3820 3830 3840 3850
SGGSIQTMSE NPAPHWLSDR AWRDILALSN LPAFSTFSTD FVQHLPKFQA
3860 3870 3880 3890 3900
IFDSAEPHRE PLPGIWNTYL DEFQKLLILR CLRGDKVTNA MQDFVANHLE
3910 3920 3930 3940 3950
PRFIEPQTAN LSAVFKESNS TTPLIFVLSP GTDPAADLYK FAEEMKFSKK
3960 3970 3980 3990 4000
LSAISLGQGQ GPRAEAMMRN SIERGKWVFF QNCHLAPSWM PALERLIEHI
4010 4020 4030 4040 4050
NPDKVHRDFR LWLTSLPSNK FPVSILQNGS KMTIEPPRGV KANLLKSYNS
4060 4070 4080 4090 4100
LSDDFLHSCQ KVVEFKSLLL SLCLFHGNAL ERRKFGPLGF NIPYEFTDGD
4110 4120 4130 4140 4150
LRICISQLKM FLDEYEDIPY KVLKYTAGEI NYGGRVTDDW DRRCVMNILE
4160 4170 4180 4190 4200
DFYNPAVLSP EHRYSKSGIY HQIPPTYDLN GYLSYIKSLP LNDMPEIFGL
4210 4220 4230 4240 4250
HDNANITFAQ NETFALFGAI LQLQPKSSSM GGQSREELVE DVAEDILVQV
4260 4270 4280 4290 4300
PKPVDLEEVV NKYPVLYEES MNTVLVQEVI RYNKLLMVIT QTLSDMLKAI
4310 4320 4330 4340 4350
KGLVVMSLEL ELMSTSLYNN AVPELWKSKA YPSLKPLASW IMDLLQRLNF
4360 4370 4380 4390 4400
LHSWIKNGIP SVFWISGFFF PQAFLTGTLQ NFARKFVISI DTITFDFKVL
4410 4420 4430 4440 4450
SYASSEIAER PSTGCYIYGL FLEGARWDPF DFQLAESRPK ELYTEMAVIW
4460 4470 4480 4490 4500
LLPVANRKVQ NQDFYLCPIY KTLTRAGTLS TTGHSTNYVI AVEIPSNQPQ
4510
RHWIKRGVAL ICALDY
Length:4,516
Mass (Da):515,021
Last modified:February 26, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF46AC5E8DCCC0BAF
GO
Isoform 2 (identifier: Q63164-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1867-1890: SREYIKSLGGAVMCLPFLCVLYVQ → VERFMFEGVEIPLVPSCAVFITMNPGYAGRTELPDNLK

Show »
Length:4,530
Mass (Da):516,573
Checksum:i2590FAEDB47EE081
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3ZRN8D3ZRN8_RAT
Dynein heavy chain 1, axonemal
Dnah1
4,250Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0313091867 – 1890SREYI…VLYVQ → VERFMFEGVEIPLVPSCAVF ITMNPGYAGRTELPDNLK in isoform 2. 1 PublicationAdd BLAST24

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AABR03100255 Genomic DNA No translation available.
AABR03101829 Genomic DNA No translation available.
AABR03101330 Genomic DNA No translation available.
D26492 mRNA Translation: BAA05500.1

Protein sequence database of the Protein Information Resource

More...
PIRi
I70171

NCBI Reference Sequences

More...
RefSeqi
NP_001028827.2, NM_001033655.2

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSRNOT00000035009; ENSRNOP00000032434; ENSRNOG00000026914 [Q63164-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
171339

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
rno:171339

UCSC genome browser

More...
UCSCi
RGD:621795, rat [Q63164-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AABR03100255 Genomic DNA No translation available.
AABR03101829 Genomic DNA No translation available.
AABR03101330 Genomic DNA No translation available.
D26492 mRNA Translation: BAA05500.1
PIRiI70171
RefSeqiNP_001028827.2, NM_001033655.2

3D structure databases

SMRiQ63164
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000059841

PTM databases

CarbonylDBiQ63164
iPTMnetiQ63164
PhosphoSitePlusiQ63164

Proteomic databases

PaxDbiQ63164
PRIDEiQ63164

Genome annotation databases

EnsembliENSRNOT00000035009; ENSRNOP00000032434; ENSRNOG00000026914 [Q63164-1]
GeneIDi171339
KEGGirno:171339
UCSCiRGD:621795, rat [Q63164-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
25981
RGDi621795, Dnah1

Phylogenomic databases

eggNOGiKOG3595, Eukaryota
GeneTreeiENSGT00940000154791
HOGENOMiCLU_000038_0_0_1
InParanoidiQ63164
KOiK10408
OMAiQTQDFID
OrthoDBi3185at2759
PhylomeDBiQ63164

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q63164

Gene expression databases

BgeeiENSRNOG00000026914, Expressed in testis and 18 other tissues
ExpressionAtlasiQ63164, baseline and differential
GenevisibleiQ63164, RN

Family and domain databases

Gene3Di1.10.8.720, 1 hit
1.20.140.100, 1 hit
3.10.490.20, 1 hit
3.20.180.20, 1 hit
InterProiView protein in InterPro
IPR035699, AAA_6
IPR035706, AAA_9
IPR041658, AAA_lid_11
IPR042219, AAA_lid_11_sf
IPR026983, DHC_fam
IPR026975, DNAH1
IPR041589, DNAH3_AAA_lid_1
IPR042228, Dynein_2_C
IPR042222, Dynein_2_N
IPR041466, Dynein_AAA5_ext
IPR041228, Dynein_C
IPR043160, Dynein_C_barrel
IPR024743, Dynein_HC_stalk
IPR024317, Dynein_heavy_chain_D4_dom
IPR004273, Dynein_heavy_D6_P-loop
IPR013602, Dynein_heavy_dom-2
IPR027417, P-loop_NTPase
PANTHERiPTHR10676, PTHR10676, 1 hit
PTHR10676:SF358, PTHR10676:SF358, 1 hit
PfamiView protein in Pfam
PF12774, AAA_6, 2 hits
PF12780, AAA_8, 1 hit
PF12781, AAA_9, 1 hit
PF17857, AAA_lid_1, 1 hit
PF18198, AAA_lid_11, 1 hit
PF08393, DHC_N2, 1 hit
PF17852, Dynein_AAA_lid, 1 hit
PF18199, Dynein_C, 1 hit
PF03028, Dynein_heavy, 1 hit
PF12777, MT, 1 hit
SUPFAMiSSF52540, SSF52540, 4 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDYH1_RAT
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q63164
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: August 12, 2020
This is version 116 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again