Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

5-hydroxytryptamine receptor 4

Gene

Htr4

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase.

GO - Molecular functioni

  • G-protein coupled serotonin receptor activity Source: RGD

GO - Biological processi

Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Names & Taxonomyi

Protein namesi
Recommended name:
5-hydroxytryptamine receptor 4
Short name:
5-HT-4
Short name:
5-HT4
Alternative name(s):
Serotonin receptor 4
Gene namesi
Name:Htr4
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi2850 Htr4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 19ExtracellularBy similarityAdd BLAST19
Transmembranei20 – 40Helical; Name=1By similarityAdd BLAST21
Topological domaini41 – 58CytoplasmicBy similarityAdd BLAST18
Transmembranei59 – 79Helical; Name=2By similarityAdd BLAST21
Topological domaini80 – 93ExtracellularBy similarityAdd BLAST14
Transmembranei94 – 116Helical; Name=3By similarityAdd BLAST23
Topological domaini117 – 137CytoplasmicBy similarityAdd BLAST21
Transmembranei138 – 158Helical; Name=4By similarityAdd BLAST21
Topological domaini159 – 192ExtracellularBy similarityAdd BLAST34
Transmembranei193 – 213Helical; Name=5By similarityAdd BLAST21
Topological domaini214 – 260CytoplasmicBy similarityAdd BLAST47
Transmembranei261 – 281Helical; Name=6By similarityAdd BLAST21
Topological domaini282 – 294ExtracellularBy similarityAdd BLAST13
Transmembranei295 – 315Helical; Name=7By similarityAdd BLAST21
Topological domaini316 – 406CytoplasmicBy similarityAdd BLAST91

Keywords - Cellular componenti

Cell membrane, Endosome, Membrane

Pathology & Biotechi

Chemistry databases

ChEMBLiCHEMBL4317
GuidetoPHARMACOLOGYi9

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000689681 – 4065-hydroxytryptamine receptor 4Add BLAST406

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi7N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi93 ↔ 184PROSITE-ProRule annotation
Lipidationi329S-palmitoyl cysteineBy similarity1

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate

Proteomic databases

PaxDbiQ62758
PRIDEiQ62758

PTM databases

PhosphoSitePlusiQ62758

Expressioni

Tissue specificityi

In brain, isoform 5-HT4S is restricted to the striatum, but isoform 5-HT4L is expressed throughout the brain, except in the cerebellum. In peripheral tissues, differential expression is also observed in the atrium of the heart where only isoform 5-HT4S is detectable.

Interactioni

Subunit structurei

May interact with PATJ, MAGI2, MPP3, NOS1, SLC9A3R1, SEC23A and SNX27. May form a complex including SLC9A3R1 and EZR (By similarity). Interacts (via C-terminus 330-346 AA) with GRK5; this interaction is promoted by 5-HT (serotonin) (By similarity).By similarity

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000025892

Chemistry databases

BindingDBiQ62758

Structurei

3D structure databases

ProteinModelPortaliQ62758
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3656 Eukaryota
ENOG410XRW9 LUCA
HOGENOMiHOG000239242
HOVERGENiHBG106962
InParanoidiQ62758
KOiK04160
PhylomeDBiQ62758

Family and domain databases

CDDicd15056 7tmA_5-HT4, 1 hit
InterProiView protein in InterPro
IPR001520 5HT4_rcpt
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
PfamiView protein in Pfam
PF00001 7tm_1, 1 hit
PRINTSiPR01059 5HT4RECEPTR
PR00237 GPCRRHODOPSN
SMARTiView protein in SMART
SM01381 7TM_GPCR_Srsx, 1 hit
PROSITEiView protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.iShow all

Isoform 5-HT4L (identifier: Q62758-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDRLDANVSS NEGFGSVEKV VLLTFFAMVI LMAILGNLLV MVAVCRDRQL
60 70 80 90 100
RKIKTNYFIV SLAFADLLVS VLVNAFGAIE LVQDIWFYGE MFCLVRTSLD
110 120 130 140 150
VLLTTASIFH LCCISLDRYY AICCQPLVYR NKMTPLRIAL MLGGCWVIPM
160 170 180 190 200
FISFLPIMQG WNNIGIVDVI EKRKFNHNSN STFCVFMVNK PYAITCSVVA
210 220 230 240 250
FYIPFLLMVL AYYRIYVTAK EHAQQIQMLQ RAGATSESRP QTADQHSTHR
260 270 280 290 300
MRTETKAAKT LCVIMGCFCF CWAPFFVTNI VDPFIDYTVP EKVWTAFLWL
310 320 330 340 350
GYINSGLNPF LYAFLNKSFR RAFLIILCCD DERYKRPPIL GQTVPCSTTT
360 370 380 390 400
INGSTHVLRD TVECGGQWES RCHLTATSPL VAAQPVIRRP QDNDLEDSCS

LKRSQS
Length:406
Mass (Da):46,107
Last modified:November 1, 1996 - v1
Checksum:iA1889155A08930B4
GO
Isoform 5-HT4S (identifier: Q62758-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-406: DTVECGGQWESRCHLTATSPLVAAQPVIRRPQDNDLEDSCSLKRSQS → YTVLHSGQHQELEKLPIHNDPESLESCF

Show »
Length:387
Mass (Da):44,173
Checksum:i09B2236DF4978D3A
GO
Isoform 5-HT4(E) (identifier: Q62758-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     359-406: RDTVECGGQWESRCHLTATSPLVAAQPVIRRPQDNDLEDSCSLKRSQS → SFPLLFCNRPVPV

Show »
Length:371
Mass (Da):42,254
Checksum:i7D5F0B514486BDA1
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F1LM90F1LM90_RAT
5-hydroxytryptamine receptor 4
Htr4
406Annotation score:
A0A140UHX7A0A140UHX7_RAT
5-hydroxytryptamine receptor 4
Htr4
379Annotation score:
A0A0G2QC07A0A0G2QC07_RAT
5-hydroxytryptamine receptor 4
Htr4
372Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti74 – 75NA → MP in CAA09599 (PubMed:10220570).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_001855359 – 406RDTVE…KRSQS → SFPLLFCNRPVPV in isoform 5-HT4(E). CuratedAdd BLAST48
Alternative sequenceiVSP_001854360 – 406DTVEC…KRSQS → YTVLHSGQHQELEKLPIHND PESLESCF in isoform 5-HT4S. CuratedAdd BLAST47

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U20907 mRNA Translation: AAC52233.1
U20906 mRNA Translation: AAC52232.1
Z48153 mRNA Translation: CAA88170.1
AJ011370 mRNA Translation: CAA09599.1
PIRiS55549
S55550
RefSeqiNP_036985.1, NM_012853.1 [Q62758-1]
UniGeneiRn.10094

Genome annotation databases

GeneIDi25324
KEGGirno:25324
UCSCiRGD:2850 rat [Q62758-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U20907 mRNA Translation: AAC52233.1
U20906 mRNA Translation: AAC52232.1
Z48153 mRNA Translation: CAA88170.1
AJ011370 mRNA Translation: CAA09599.1
PIRiS55549
S55550
RefSeqiNP_036985.1, NM_012853.1 [Q62758-1]
UniGeneiRn.10094

3D structure databases

ProteinModelPortaliQ62758
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000025892

Chemistry databases

BindingDBiQ62758
ChEMBLiCHEMBL4317
GuidetoPHARMACOLOGYi9

Protein family/group databases

GPCRDBiSearch...

PTM databases

PhosphoSitePlusiQ62758

Proteomic databases

PaxDbiQ62758
PRIDEiQ62758

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi25324
KEGGirno:25324
UCSCiRGD:2850 rat [Q62758-1]

Organism-specific databases

CTDi3360
RGDi2850 Htr4

Phylogenomic databases

eggNOGiKOG3656 Eukaryota
ENOG410XRW9 LUCA
HOGENOMiHOG000239242
HOVERGENiHBG106962
InParanoidiQ62758
KOiK04160
PhylomeDBiQ62758

Miscellaneous databases

PROiPR:Q62758

Family and domain databases

CDDicd15056 7tmA_5-HT4, 1 hit
InterProiView protein in InterPro
IPR001520 5HT4_rcpt
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
PfamiView protein in Pfam
PF00001 7tm_1, 1 hit
PRINTSiPR01059 5HT4RECEPTR
PR00237 GPCRRHODOPSN
SMARTiView protein in SMART
SM01381 7TM_GPCR_Srsx, 1 hit
PROSITEiView protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry namei5HT4R_RAT
AccessioniPrimary (citable) accession number: Q62758
Secondary accession number(s): O89034, Q62757, Q63006
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1996
Last modified: May 23, 2018
This is version 140 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again