Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 145 (12 Aug 2020)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4

Gene

Plcd4

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Hydrolyzes the phosphatidylinositol 4,5-bisphosphate (PIP2) to generate 2 second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). DAG mediates the activation of protein kinase C (PKC), while IP3 releases Ca2+ from intracellular stores. Required for acrosome reaction in sperm during fertilization, probably by acting as an important enzyme for intracellular Ca2+ mobilization in the zona pellucida-induced acrosome reaction. May play a role in cell growth. Modulates the liver regeneration in cooperation with nuclear PKC. Overexpression up-regulates the Erk signaling pathway and proliferation.1 Publication
Has no enzyme activity and acts as a negative regulator of phospholipase C, with a preference for thePLC-delta family.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Ca2+1 PublicationNote: Binds 3 Ca2+ ions per subunit. Two of the Ca2+ ions are bound to the C2 domain.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei305PROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi306Calcium 1; catalyticBy similarity1
Metal bindingi335Calcium 1; catalyticBy similarity1
Metal bindingi337Calcium 1; catalyticBy similarity1
Active sitei350PROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei433SubstrateBy similarity1
Binding sitei435SubstrateBy similarity1
Binding sitei532SubstrateBy similarity1
Binding sitei559SubstrateBy similarity1
Metal bindingi662Calcium 2By similarity1
Metal bindingi686Calcium 2By similarity1
Metal bindingi715Calcium 3By similarity1
Metal bindingi716Calcium 3; via carbonyl oxygenBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) of the calcium-binding region(s) within the protein. One common calcium-binding motif is the EF-hand, but other calcium-binding motifs also exist.<p><a href='/help/ca_bind' target='_top'>More...</a></p>Calcium bindingi147 – 1581PROSITE-ProRule annotationAdd BLAST12
Calcium bindingi183 – 1942PROSITE-ProRule annotationAdd BLAST12

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Transducer
Biological processLipid degradation, Lipid metabolism
LigandCalcium, Metal-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.1.4.11, 5301

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-RNO-1855204, Synthesis of IP3 and IP4 in the cytosol

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...
SwissLipidsi
SLP:000001069

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 (EC:3.1.4.11)
Alternative name(s):
Phosphoinositide phospholipase C-delta-4
Phospholipase C-delta-4
Short name:
PLC-delta-4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Plcd4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Rat genome database

More...
RGDi
621025, Plcd4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Endoplasmic reticulum, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi36R → G: Only retains weak enzyme activity and abolishes the ability of isoform 4 to act as a negative regulator. 1 Publication1
Mutagenesisi714K → E: Abolishes affinity for POPC/POPS in the absence of Ca(2+); when associated with E-718. 1 Publication1
Mutagenesisi717S → D: Induces a larger Ca(2+)-dependence. 1 Publication1
Mutagenesisi718R → E: Abolishes affinity for POPC/POPS in the absence of Ca(2+); when associated with E-714. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003068291 – 7721-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4Add BLAST772

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei445PhosphoserineCombined sources1
Modified residuei458PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q62711

PRoteomics IDEntifications database

More...
PRIDEi
Q62711

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q62711

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q62711

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Present at high level in testis. Also present in brain > skeletal muscle > thyroid gland > stomach > thymus > aorta > heart (at protein level). Highly expressed in regenerating liver. Isoform 4 is weakly expressed compared to other isoforms but is expressed at high level in some neural cells.2 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Increases at the transition from G1- to S-phase, and the continues to the end of M-phase. Almost disappears when cells reenter the next G1-phase.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By serum treatment.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSRNOG00000016361, Expressed in testis and 22 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q62711, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q62711, RN

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with GRIP1 (By similarity).

Interacts (via GBA motif) with guanine nucleotide-binding protein G(i) alpha subunit GNAI3 (inactive GDP-bound form); low-affinity interaction (By similarity).

By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10116.ENSRNOP00000022234

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q62711

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q62711

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini16 – 124PHPROSITE-ProRule annotationAdd BLAST109
Domaini134 – 169EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini170 – 205EF-hand 2PROSITE-ProRule annotationAdd BLAST36
Domaini203 – 237EF-hand 3PROSITE-ProRule annotationAdd BLAST35
Domaini290 – 435PI-PLC X-boxPROSITE-ProRule annotationAdd BLAST146
Domaini503 – 619PI-PLC Y-boxPROSITE-ProRule annotationAdd BLAST117
Domaini619 – 746C2PROSITE-ProRule annotationAdd BLAST128

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni26 – 53Substrate bindingBy similarityAdd BLAST28

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi213 – 243GBABy similarityAdd BLAST31
Motifi741 – 744PDZ-binding4

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi448 – 453Poly-Glu6

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The PDZ-binding motif mediates the interaction with GRIP1.By similarity
The C2 domain mediates pre-localization to the membrane prior to Ca2+ import and non-selective Ca2+-mediated targeting to various cellular membranes.
The PH domain is not a critical determinant of the membrane localization. The PH domain of isoform 4 is necessary and sufficient to inhibit enzyme activity of other PLC-delta enzymes.
The GBA (G-alpha binding and activating) motif mediates binding to the alpha subunits of guanine nucleotide-binding proteins (G proteins).By similarity

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0169, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156180

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_002738_0_2_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q62711

KEGG Orthology (KO)

More...
KOi
K05857

Database of Orthologous Groups

More...
OrthoDBi
368239at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q62711

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit
2.60.40.150, 1 hit
3.20.20.190, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000008, C2_dom
IPR035892, C2_domain_sf
IPR011992, EF-hand-dom_pair
IPR018247, EF_Hand_1_Ca_BS
IPR002048, EF_hand_dom
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR001192, PI-PLC_fam
IPR028387, PLC-delta4
IPR017946, PLC-like_Pdiesterase_TIM-brl
IPR015359, PLC_EF-hand-like
IPR000909, PLipase_C_PInositol-sp_X_dom
IPR001711, PLipase_C_Pinositol-sp_Y

The PANTHER Classification System

More...
PANTHERi
PTHR10336, PTHR10336, 1 hit
PTHR10336:SF31, PTHR10336:SF31, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00168, C2, 1 hit
PF09279, EF-hand_like, 1 hit
PF00169, PH, 1 hit
PF00388, PI-PLC-X, 1 hit
PF00387, PI-PLC-Y, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00390, PHPHLIPASEC

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00239, C2, 1 hit
SM00054, EFh, 3 hits
SM00233, PH, 1 hit
SM00148, PLCXc, 1 hit
SM00149, PLCYc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47473, SSF47473, 1 hit
SSF51695, SSF51695, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50004, C2, 1 hit
PS00018, EF_HAND_1, 1 hit
PS50222, EF_HAND_2, 3 hits
PS50003, PH_DOMAIN, 1 hit
PS50007, PIPLC_X_DOMAIN, 1 hit
PS50008, PIPLC_Y_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q62711-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASQIQKLLT TNQDLLLMQK GTMMRKVRTK SWKKLRYFRL QDDGMTVWHG
60 70 80 90 100
RHLESISKPT FSISDVERIR KGQDSELLRY LVEEFPLEQG FTIVFNGRRP
110 120 130 140 150
NLDLVANSVE EAQTWMRGLQ LLVDLVARMN YQEQLDQMLR EWFQQADRNQ
160 170 180 190 200
DSRMSFREAQ RLLLLMNVEM DEEYAFSLFQ EADVSQSNTL DSEEFVQFYK
210 220 230 240 250
ALTKRTEIEE LFENFSSDKQ KLTLLEFVDF LREEQKESDH SSDLALKLID
260 270 280 290 300
RYEPSENGRL LRVLSKDGFL SYLCSADGNI FNPDCLPIYQ DMTQPLSHYY
310 320 330 340 350
INSSHNTYLL GDQFCGQSSV EGYIRALKRG CRCVEVDTWD GPDGEPVVYH
360 370 380 390 400
GRTLTSRILF KDVLATLAQY AFQSSDYPLI LSLDNHCTWE QQKTMAHHLI
410 420 430 440 450
AILGEQLLST TLEEQLIDIM PSPEQLRGKI LVKGKKLRTI EVVESDKEEE
460 470 480 490 500
ELEKDEGSDL DPASAELDMQ SQPESQEQAS GNKSKNKKKF LLQSSTTILC
510 520 530 540 550
PDLSALVVYL RTAPFCSFTH SKENYHIYDI SSFSESKAKN LIREAGNEFV
560 570 580 590 600
QHNARQLCRV YPSGLRTDSS NYNPQEHWNV GCQMVAMNMQ TAGSAMDICD
610 620 630 640 650
GLFRQNGGSG YVLKPEFLRD TQSSFNPMKP VSLYKAQILV VQVISGQRLP
660 670 680 690 700
KVDKTKETTV VDPLVRVELY GVPEDTKQQE TSYVENNGIN PYWGETFYFQ
710 720 730 740 750
IQVPELAMLR FVVKDYSRTS RNNFIGQYTL PWTCMKHGYR HVSLLSKDGT
760 770
SLHPASIFVY TCMQEDLDMD EP
Length:772
Mass (Da):88,967
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5DD56D1D4AA21356
GO
Isoform 2 (identifier: Q62711-2) [UniParc]FASTAAdd to basket
Also known as: ALT I

The sequence of this isoform differs from the canonical sequence as follows:
     487-487: K → KVMKCPMSCLLICVHVLAQAPNSIPESILLP

Show »
Length:802
Mass (Da):92,170
Checksum:i182467F673D92243
GO
Isoform 3 (identifier: Q62711-3) [UniParc]FASTAAdd to basket
Also known as: ALT II

The sequence of this isoform differs from the canonical sequence as follows:
     487-487: K → KAPNSIPESILLP

Show »
Length:784
Mass (Da):90,199
Checksum:i17D1E14860897530
GO
Isoform 4 (identifier: Q62711-4) [UniParc]FASTAAdd to basket
Also known as: ALT III

The sequence of this isoform differs from the canonical sequence as follows:
     424-487: EQLRGKILVK...QASGNKSKNK → VMKCPMSCLLICVHVLAQAPNSIPESILLPKR

Note: Inactive.Curated
Show »
Length:740
Mass (Da):85,314
Checksum:iB0C008AAA45E7F9A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3ZP94D3ZP94_RAT
Phosphoinositide phospholipase C
Plcd4
786Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti395M → ML in BAA09046 (PubMed:8550586).Curated1
Sequence conflicti416Missing in BAA09046 (PubMed:8550586).Curated1
Sequence conflicti425Missing in BAA09046 (PubMed:8550586).Curated1
Sequence conflicti757I → H in BAA09046 (PubMed:8550586).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_028507424 – 487EQLRG…KSKNK → VMKCPMSCLLICVHVLAQAP NSIPESILLPKR in isoform 4. CuratedAdd BLAST64
Alternative sequenceiVSP_028508487K → KVMKCPMSCLLICVHVLAQA PNSIPESILLP in isoform 2. 1 Publication1
Alternative sequenceiVSP_028509487K → KAPNSIPESILLP in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U16655 mRNA Translation: AAC52346.1
D50455 mRNA Translation: BAA09046.1

NCBI Reference Sequences

More...
RefSeqi
NP_542419.1, NM_080688.1 [Q62711-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSRNOT00000041407; ENSRNOP00000039708; ENSRNOG00000016361 [Q62711-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
140693

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
rno:140693

UCSC genome browser

More...
UCSCi
RGD:621025, rat [Q62711-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U16655 mRNA Translation: AAC52346.1
D50455 mRNA Translation: BAA09046.1
RefSeqiNP_542419.1, NM_080688.1 [Q62711-1]

3D structure databases

SMRiQ62711
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000022234

Chemistry databases

BindingDBiQ62711
SwissLipidsiSLP:000001069

PTM databases

iPTMnetiQ62711
PhosphoSitePlusiQ62711

Proteomic databases

PaxDbiQ62711
PRIDEiQ62711

Genome annotation databases

EnsembliENSRNOT00000041407; ENSRNOP00000039708; ENSRNOG00000016361 [Q62711-1]
GeneIDi140693
KEGGirno:140693
UCSCiRGD:621025, rat [Q62711-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84812
RGDi621025, Plcd4

Phylogenomic databases

eggNOGiKOG0169, Eukaryota
GeneTreeiENSGT00940000156180
HOGENOMiCLU_002738_0_2_1
InParanoidiQ62711
KOiK05857
OrthoDBi368239at2759
PhylomeDBiQ62711

Enzyme and pathway databases

BRENDAi3.1.4.11, 5301
ReactomeiR-RNO-1855204, Synthesis of IP3 and IP4 in the cytosol

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q62711

Gene expression databases

BgeeiENSRNOG00000016361, Expressed in testis and 22 other tissues
ExpressionAtlasiQ62711, baseline and differential
GenevisibleiQ62711, RN

Family and domain databases

Gene3Di2.30.29.30, 1 hit
2.60.40.150, 1 hit
3.20.20.190, 1 hit
InterProiView protein in InterPro
IPR000008, C2_dom
IPR035892, C2_domain_sf
IPR011992, EF-hand-dom_pair
IPR018247, EF_Hand_1_Ca_BS
IPR002048, EF_hand_dom
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR001192, PI-PLC_fam
IPR028387, PLC-delta4
IPR017946, PLC-like_Pdiesterase_TIM-brl
IPR015359, PLC_EF-hand-like
IPR000909, PLipase_C_PInositol-sp_X_dom
IPR001711, PLipase_C_Pinositol-sp_Y
PANTHERiPTHR10336, PTHR10336, 1 hit
PTHR10336:SF31, PTHR10336:SF31, 1 hit
PfamiView protein in Pfam
PF00168, C2, 1 hit
PF09279, EF-hand_like, 1 hit
PF00169, PH, 1 hit
PF00388, PI-PLC-X, 1 hit
PF00387, PI-PLC-Y, 1 hit
PRINTSiPR00390, PHPHLIPASEC
SMARTiView protein in SMART
SM00239, C2, 1 hit
SM00054, EFh, 3 hits
SM00233, PH, 1 hit
SM00148, PLCXc, 1 hit
SM00149, PLCYc, 1 hit
SUPFAMiSSF47473, SSF47473, 1 hit
SSF51695, SSF51695, 1 hit
PROSITEiView protein in PROSITE
PS50004, C2, 1 hit
PS00018, EF_HAND_1, 1 hit
PS50222, EF_HAND_2, 3 hits
PS50003, PH_DOMAIN, 1 hit
PS50007, PIPLC_X_DOMAIN, 1 hit
PS50008, PIPLC_Y_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPLCD4_RAT
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q62711
Secondary accession number(s): Q63693
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: November 1, 1996
Last modified: August 12, 2020
This is version 145 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again