Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Integrin alpha-3

Gene

Itga3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Integrin alpha-3/beta-1 is a receptor for fibronectin, laminin, collagen, epiligrin, thrombospondin and CSPG4. Integrin alpha-3/beta-1 provides a docking site for FAP (seprase) at invadopodia plasma membranes in a collagen-dependent manner and hence may participate in the adhesion, formation of invadopodia and matrix degradation processes, promoting cell invasion. Alpha-3/beta-1 may mediate with LGALS3 the stimulation by CSPG4 of endothelial cells migration.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIntegrin, Receptor
Biological processCell adhesion

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-210991 Basigin interactions
R-MMU-216083 Integrin cell surface interactions
R-MMU-3000157 Laminin interactions
R-MMU-8874081 MET activates PTK2 signaling

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Integrin alpha-3
Alternative name(s):
CD49 antigen-like family member C
Galactoprotein B3
Short name:
GAPB3
VLA-3 subunit alpha
CD_antigen: CD49c
Cleaved into the following 2 chains:
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Itga3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:96602 Itga3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini33 – 993ExtracellularSequence analysisAdd BLAST961
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei994 – 1021HelicalSequence analysisAdd BLAST28
Topological domaini1022 – 1053CytoplasmicSequence analysisAdd BLAST32

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 32By similarityAdd BLAST32
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001624133 – 1053Integrin alpha-3Add BLAST1021
ChainiPRO_000001624233 – 874Integrin alpha-3 heavy chainSequence analysisAdd BLAST842
ChainiPRO_0000016243878 – 1053Integrin alpha-3 light chainSequence analysisAdd BLAST176

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi86N-linked (GlcNAc...) asparagine2 Publications1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi94 ↔ 103By similarity
Disulfide bondi140 ↔ 162By similarity
Disulfide bondi185 ↔ 197By similarity
Disulfide bondi486 ↔ 491By similarity
Disulfide bondi497 ↔ 551By similarity
Glycosylationi501N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi512N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi574N-linked (GlcNAc...) asparagine2 Publications1
Glycosylationi606N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi616 ↔ 622By similarity
Glycosylationi657N-linked (GlcNAc...) asparagine2 Publications1
Disulfide bondi695 ↔ 704By similarity
Glycosylationi699N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi843N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi848 ↔ 906Interchain (between heavy and light chains)By similarity
Glycosylationi859N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi913 ↔ 918By similarity
Glycosylationi925N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi928N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi937N-linked (GlcNAc...) asparagine2 Publications1
Glycosylationi971N-linked (GlcNAc...) asparagine1 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi1018S-palmitoyl cysteineBy similarity1

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Lipoprotein, Palmitate

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q62470

PeptideAtlas

More...
PeptideAtlasi
Q62470

PRoteomics IDEntifications database

More...
PRIDEi
Q62470

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q62470

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q62470

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q62470

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
Q62470

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 and isoform 2 are expressed in heart and brain. Only isoform 1 is detected in lung.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000001507 Expressed in 336 organ(s), highest expression level in decidua

CleanEx database of gene expression profiles

More...
CleanExi
MM_ITGA3

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q62470 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q62470 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer of an alpha and a beta subunit. The alpha subunit is composed of a heavy and a light chain linked by a disulfide bond. Alpha-3 associates with beta-1. Interacts with HPS5. Interacts with FAP (seprase); the interaction occurs at the cell surface of invadopodia membrane in a collagen-dependent manner.By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
200816, 2 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-3117 Integrin alpha3-beta1 complex

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q62470

Protein interaction database and analysis system

More...
IntActi
Q62470, 1 interactor

Molecular INTeraction database

More...
MINTi
Q62470

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000001548

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q62470

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q62470

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati38 – 103FG-GAP 1PROSITE-ProRule annotationAdd BLAST66
Repeati110 – 171FG-GAP 2PROSITE-ProRule annotationAdd BLAST62
Repeati185 – 235FG-GAP 3PROSITE-ProRule annotationAdd BLAST51
Repeati236 – 293FG-GAP 4PROSITE-ProRule annotationAdd BLAST58
Repeati294 – 355FG-GAP 5PROSITE-ProRule annotationAdd BLAST62
Repeati357 – 412FG-GAP 6PROSITE-ProRule annotationAdd BLAST56
Repeati416 – 478FG-GAP 7PROSITE-ProRule annotationAdd BLAST63

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the integrin alpha chain family.Curated

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IPB6 Eukaryota
ENOG410ZZD8 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157746

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000015786

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG108011

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q62470

KEGG Orthology (KO)

More...
KOi
K06482

Identification of Orthologs from Complete Genome Data

More...
OMAi
FQKECGQ

Database of Orthologous Groups

More...
OrthoDBi
EOG091G012D

TreeFam database of animal gene trees

More...
TreeFami
TF105391

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.130, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013517 FG-GAP
IPR013519 Int_alpha_beta-p
IPR000413 Integrin_alpha
IPR013649 Integrin_alpha-2
IPR018184 Integrin_alpha_C_CS
IPR028994 Integrin_alpha_N
IPR032695 Integrin_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01839 FG-GAP, 2 hits
PF08441 Integrin_alpha2, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01185 INTEGRINA

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00191 Int_alpha, 5 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF69179 SSF69179, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51470 FG_GAP, 7 hits
PS00242 INTEGRIN_ALPHA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q62470-1) [UniParc]FASTAAdd to basket
Also known as: Alpha-3A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGPGPCRVPR APGWLLRALA LMVAACGRVA FAFNLDTRFL VVKEAVNPGS
60 70 80 90 100
LFGYSVALHR QTERQQRYLL LAGAPRDLAV GDDYTNRTGA VYLCPLTAHK
110 120 130 140 150
DDCERMDISE KSDPDHHIIE DMWLGVTVAS QGPAGRVLVC AHRYTKVLWS
160 170 180 190 200
GLEDQRRMVG KCYVRGNDLQ LDPGDDWQTY HNEMCNSNTD YLQTGMCQLG
210 220 230 240 250
TSGGFTQNTV YFGAPGAYNW KGNSYMIQRK DWDLSEYSYR GSEEQGNLYI
260 270 280 290 300
GYTVQVGNAI LHPTDIITVV TGAPRHQHMG AVFLLKQESG GDLQRKQVLK
310 320 330 340 350
GTQVGAYFGS AIALADLNND GWQDLLVGAP YYFERKEEVG GAVYVFMNQA
360 370 380 390 400
GASFPDQPSL LLHGPSRSAF GISIASIGDI NQDGFQDIAV GAPFEGLGKV
410 420 430 440 450
YIYHSSSGGL LRQPQQIIHG EKLGLPGLAT FGYSLSGKMD VDENLYPDLL
460 470 480 490 500
VGSLSDHIVL LRARPVINIL HRTLVARPAV LDPALCTATS CVQVELCFAY
510 520 530 540 550
NQSAGNPNYR RNITLAYTLE ADRDRRPPRL RFARSQSSVF HGFFSMPETH
560 570 580 590 600
CQTLELLLMD NVRDKLRPIV IAMNYSLPLR MPDRLKLGLR SLDAYPVLNQ
610 620 630 640 650
AQAMENHTEV HFQKECGPDN KCDSNLQMRA AFLSEQLQPL SRLQYSRDTK
660 670 680 690 700
KLFLSINVTN SPSSQRAGED AHEALLTLEV PSALLLSSVR PSGTCQANNE
710 720 730 740 750
TILCELGNPF KRNQRMELLI AFEVIGVTLH TRDLPVLLQL STSSHQDNLQ
760 770 780 790 800
PVLLTLQVDY TLQASLSLMN HRLQSFFGGT VMGEAAMKTA EDVGSPLKYE
810 820 830 840 850
FQVSPVGDGL AALGTLVLGL EWPYEVTNGK WLLYPTEITI HSNGSWPCQP
860 870 880 890 900
SGNLVNPLNL TLSDPGVTPL SPQRRRRQLD PGGDQSSPPV TLAAAKKAKS
910 920 930 940 950
ETVLTCSNGR ARCVWLECPL PDTSNITNVT VKARVWNSTF IEDYKDFDRV
960 970 980 990 1000
RVDGWATLFL RTSIPTINME NKTTWFSVDI DSELVEELPA EIELWLVLVA
1010 1020 1030 1040 1050
VGAGLLLLGL IILLLWKCGF FKRARTRALY EAKRQKAEMK SQPSETERLT

DDY
Length:1,053
Mass (Da):116,745
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6A5E8FBDBA86D6E5
GO
Isoform 2 (identifier: Q62470-2) [UniParc]FASTAAdd to basket
Also known as: Alpha-3B

The sequence of this isoform differs from the canonical sequence as follows:
     1019-1053: GFFKRARTRALYEAKRQKAEMKSQPSETERLTDDY → DFFKPTRYYR...TSWQIRDRYY

Show »
Length:1,068
Mass (Da):118,884
Checksum:i59B6FC2CE79A454E
GO
Isoform 3 (identifier: Q62470-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-69: MGPGPCRVPR...RQTERQQRYL → MSYLQTLVWS...RLTHPPSFSS

Note: No experimental confirmation available.
Show »
Length:1,022
Mass (Da):113,428
Checksum:i75C3A44264E59A6D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F6UD16F6UD16_MOUSE
Integrin alpha-3
Itga3
183Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti975W → C in AAB20356 (PubMed:1946438).Curated1
Sequence conflicti975W → C in AAB20357 (PubMed:1946438).Curated1
Sequence conflicti979D → N in AAB20356 (PubMed:1946438).Curated1
Sequence conflicti979D → N in AAB20357 (PubMed:1946438).Curated1
Sequence conflicti1002G → S in AAB20356 (PubMed:1946438).Curated1
Sequence conflicti1002G → S in AAB20357 (PubMed:1946438).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0417971 – 69MGPGP…QQRYL → MSYLQTLVWSPCSESVDLQA DWREACKARLTHPPSFSS in isoform 3. CuratedAdd BLAST69
Alternative sequenceiVSP_0027221019 – 1053GFFKR…LTDDY → DFFKPTRYYRIMPKYHAVRI REEDRYPPPGSTLPTKKHWV TSWQIRDRYY in isoform 2. CuratedAdd BLAST35

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D13867 mRNA Translation: BAA02980.1
AL606480 Genomic DNA No translation available.
BC053031 mRNA Translation: AAH53031.1
BC062205 mRNA Translation: AAH62205.1
S66292 mRNA Translation: AAB20356.2
S66294 mRNA Translation: AAB20357.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS25271.1 [Q62470-1]
CCDS83877.1 [Q62470-3]
CCDS83878.1 [Q62470-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
B41543
I55534

NCBI Reference Sequences

More...
RefSeqi
NP_001293000.1, NM_001306071.1 [Q62470-3]
NP_001293091.1, NM_001306162.1 [Q62470-2]
NP_038593.1, NM_013565.3 [Q62470-1]
XP_006532373.1, XM_006532310.3 [Q62470-2]
XP_006532374.1, XM_006532311.3 [Q62470-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.57035

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000001548; ENSMUSP00000001548; ENSMUSG00000001507 [Q62470-1]
ENSMUST00000107739; ENSMUSP00000103368; ENSMUSG00000001507 [Q62470-3]
ENSMUST00000120375; ENSMUSP00000113556; ENSMUSG00000001507 [Q62470-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
16400

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:16400

UCSC genome browser

More...
UCSCi
uc007kzv.1 mouse [Q62470-3]
uc007kzw.1 mouse [Q62470-1]
uc007kzx.1 mouse [Q62470-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D13867 mRNA Translation: BAA02980.1
AL606480 Genomic DNA No translation available.
BC053031 mRNA Translation: AAH53031.1
BC062205 mRNA Translation: AAH62205.1
S66292 mRNA Translation: AAB20356.2
S66294 mRNA Translation: AAB20357.2
CCDSiCCDS25271.1 [Q62470-1]
CCDS83877.1 [Q62470-3]
CCDS83878.1 [Q62470-2]
PIRiB41543
I55534
RefSeqiNP_001293000.1, NM_001306071.1 [Q62470-3]
NP_001293091.1, NM_001306162.1 [Q62470-2]
NP_038593.1, NM_013565.3 [Q62470-1]
XP_006532373.1, XM_006532310.3 [Q62470-2]
XP_006532374.1, XM_006532311.3 [Q62470-1]
UniGeneiMm.57035

3D structure databases

ProteinModelPortaliQ62470
SMRiQ62470
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi200816, 2 interactors
ComplexPortaliCPX-3117 Integrin alpha3-beta1 complex
CORUMiQ62470
IntActiQ62470, 1 interactor
MINTiQ62470
STRINGi10090.ENSMUSP00000001548

PTM databases

iPTMnetiQ62470
PhosphoSitePlusiQ62470
SwissPalmiQ62470

Proteomic databases

PaxDbiQ62470
PeptideAtlasiQ62470
PRIDEiQ62470

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000001548; ENSMUSP00000001548; ENSMUSG00000001507 [Q62470-1]
ENSMUST00000107739; ENSMUSP00000103368; ENSMUSG00000001507 [Q62470-3]
ENSMUST00000120375; ENSMUSP00000113556; ENSMUSG00000001507 [Q62470-2]
GeneIDi16400
KEGGimmu:16400
UCSCiuc007kzv.1 mouse [Q62470-3]
uc007kzw.1 mouse [Q62470-1]
uc007kzx.1 mouse [Q62470-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
3675
MGIiMGI:96602 Itga3

Phylogenomic databases

eggNOGiENOG410IPB6 Eukaryota
ENOG410ZZD8 LUCA
GeneTreeiENSGT00940000157746
HOGENOMiHOG000015786
HOVERGENiHBG108011
InParanoidiQ62470
KOiK06482
OMAiFQKECGQ
OrthoDBiEOG091G012D
TreeFamiTF105391

Enzyme and pathway databases

ReactomeiR-MMU-210991 Basigin interactions
R-MMU-216083 Integrin cell surface interactions
R-MMU-3000157 Laminin interactions
R-MMU-8874081 MET activates PTK2 signaling

Miscellaneous databases

PMAP-CutDBiQ62470

Protein Ontology

More...
PROi
PR:Q62470

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000001507 Expressed in 336 organ(s), highest expression level in decidua
CleanExiMM_ITGA3
ExpressionAtlasiQ62470 baseline and differential
GenevisibleiQ62470 MM

Family and domain databases

Gene3Di2.130.10.130, 1 hit
InterProiView protein in InterPro
IPR013517 FG-GAP
IPR013519 Int_alpha_beta-p
IPR000413 Integrin_alpha
IPR013649 Integrin_alpha-2
IPR018184 Integrin_alpha_C_CS
IPR028994 Integrin_alpha_N
IPR032695 Integrin_dom_sf
PfamiView protein in Pfam
PF01839 FG-GAP, 2 hits
PF08441 Integrin_alpha2, 1 hit
PRINTSiPR01185 INTEGRINA
SMARTiView protein in SMART
SM00191 Int_alpha, 5 hits
SUPFAMiSSF69179 SSF69179, 3 hits
PROSITEiView protein in PROSITE
PS51470 FG_GAP, 7 hits
PS00242 INTEGRIN_ALPHA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiITA3_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q62470
Secondary accession number(s): Q08441
, Q08442, Q5SWA8, Q5SWB9, Q6P6I1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 1, 1996
Last modified: December 5, 2018
This is version 168 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again