Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q62440 (TLE1_MOUSE)

Entry version 177 (08 May 2019)
Sequence version 2 (25 Mar 2003)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Transducin-like enhancer protein 1

Gene

Tle1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcriptional corepressor that binds to a number of transcription factors. Inhibits NF-kappa-B-regulated gene expression. Inhibits the transcriptional activation mediated by FOXA2, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES. Unusual function as coactivator for ESRRG (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRepressor
Biological processTranscription, Transcription regulation, Wnt signaling pathway

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-201722 Formation of the beta-catenin:TCF transactivating complex
R-MMU-3769402 Deactivation of the beta-catenin transactivating complex
R-MMU-4641265 Repression of WNT target genes

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transducin-like enhancer protein 1
Alternative name(s):
Groucho-related protein 1
Short name:
Grg-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Tle1
Synonyms:Grg1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:104636 Tle1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000512771 – 770Transducin-like enhancer protein 1Add BLAST770

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei237Phosphoserine; by CK2Sequence analysisBy similarity1
Modified residuei257Phosphoserine; by CDK1Sequence analysis1
Modified residuei261Phosphoserine; by CDK1Sequence analysis1
Modified residuei265Phosphoserine; by CDK1Sequence analysis1
Modified residuei284PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated, probably by CDK1. The degree of phosphorylation varies throughout the cell cycle, and is highest at the G2/M transition. Becomes hyperphosphorylated in response to cell differentiation and interaction with HES1 or RUNX1.2 Publications
Ubiquitinated by XIAP/BIRC4.By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q62440

PeptideAtlas

More...PeptideAtlasi		Q62440

PRoteomics IDEntifications database

More...PRIDEi		Q62440

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q62440

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q62440

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in liver and lung. Detected at slightly lower levels in heart, brain, kidney and testis. Detected in fetal and adult stomach and small intestine, in adult ileum, duodenum and colon. In adult small intestine isoform 7 and isoform 8 are most strongly expressed at the base of the crypts of Lieberkuhn.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000008305 Expressed in 330 organ(s), highest expression level in rostral migratory stream

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q62440 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q62440 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homooligomer and heterooligomer with other family members. Binds RUNX1, RUNX2, FOXA2, KDM6A, UTY, histone H3, HESX1, ESRRG and the NF-kappa-B subunit RELA.

Interacts with HES1 (via WRPW motif) (By similarity). Binds TCF7, LEF1, TCF7L1 and TCF7L2.

Interacts with SIX3 (By similarity).

Interacts with EFNB1.

By similarity2 Publications

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		204216, 11 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q62440

Protein interaction database and analysis system

More...IntActi		Q62440, 6 interactors

Molecular INTeraction database

More...MINTi		Q62440

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000072481

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q62440

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati470 – 501WD 1Add BLAST32
Repeati528 – 558WD 2Add BLAST31
Repeati572 – 602WD 3Add BLAST31
Repeati614 – 644WD 4Add BLAST31
Repeati696 – 726WD 5Add BLAST31
Repeati737 – 767WD 6Add BLAST31

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 131Q domainBy similarityAdd BLAST131
Regioni132 – 199GP domainBy similarityAdd BLAST68
Regioni200 – 266CcN domainBy similarityAdd BLAST67
Regioni267 – 450SP domainBy similarityAdd BLAST184

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi225 – 228Nuclear localization signalSequence analysis4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

WD repeat Groucho/TLE family members are characterized by 5 regions, a glutamine-rich Q domain, a glycine/proline-rich GP domain, a central CcN domain, containing a nuclear localization signal, and a serine/proline-rich SP domain. The most highly conserved are the N-terminal Q domain and the C-terminal WD-repeat domain.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the WD repeat Groucho/TLE family.Curated

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0639 Eukaryota
ENOG410XPX3 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00950000182705

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000293211

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q62440

Database of Orthologous Groups

More...OrthoDBi		546143at2759

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.130.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR005617 Groucho/TLE_N
IPR009146 Groucho_enhance
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf

The PANTHER Classification System

More...PANTHERi		PTHR10814 PTHR10814, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF03920 TLE_N, 1 hit
PF00400 WD40, 2 hits

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01850 GROUCHOFAMLY

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00320 WD40, 7 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50978 SSF50978, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00678 WD_REPEATS_1, 2 hits
PS50082 WD_REPEATS_2, 2 hits
PS50294 WD_REPEATS_REGION, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q62440-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFPQSRHPTP HQAAGQPFKF TIPESLDRIK EEFQFLQAQY HSLKLECEKL 
        60         70         80         90        100
ASEKTEMQRH YVMYYEMSYG LNIEMHKQTE IAKRLNTICA QVIPFLSQEH 
       110        120        130        140        150
QQQVAQAVER AKQVTMAELN AIIGQQQLQA QHLSHGHGPP VPLTPHPSGL 
       160        170        180        190        200
QPPGIPPLGG SASLLALSSA LSGQSHLAIK DDKKHHDAER HRDRESGTSN 
       210        220        230        240        250
SLLVPDSLRS TDKRRNGPEF SSDIKKRKVD DKDNYDSDGD KSDDNLVVDV 
       260        270        280        290        300
SNEDPSSPHA SPTHSPRENG IDKNRLLKKD ASGSPASTAS SGSSSSLKSK 
       310        320        330        340        350
EVSLHEKANT PVLKSSTPTP RSDMPTPGTS ATPGLRPGLG KPPAMEPLVN 
       360        370        380        390        400
QAAAGLRTPL AVPGPYPAPF GMVPHAGMNG ELTSPGAAYA GLHSMSPQMS 
       410        420        430        440        450
AAAAAAAAAV VAYGRSPMVG FDPPPHMRVP SIPPNLAGIP GGKPAYSFHV 
       460        470        480        490        500
TADGQMQPVP FPPDALIGPG IPRHARQINT LNHGEVVCAV TISNPTRHVY 
       510        520        530        540        550
TGGKGCVKVW DISHPGNKSP VSQLDCLNRD NYIRSCKLLP DGCTLIVGGE 
       560        570        580        590        600
ASTLSIWDLA APTPRIKAEL TSSAPACYAL AISPDSKVCF SCCSDGNIAV 
       610        620        630        640        650
WDLHNQTLVR QFQGHTDGAS CIDISNDGTK LWTGGLDNTV RSWDLREGRQ 
       660        670        680        690        700
LQQHDFTSQI FSLGYCPTGE WLAVGMESSN VEVLHVNKPD KYQLHLHESC 
       710        720        730        740        750
VLSLKFAYCG KWFVSTGKDN LLNAWRTPYG ASIFQSKESS SVLSCDISVD 
       760        770
DKYIVTGSGD KKATVYEVIY
Length:770
Mass (Da):83,097
Last modified:March 25, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i65803C8F39BB0703
GO
Isoform 2 (identifier: Q62440-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     125-198: Missing.

Show »
Length:696
Mass (Da):75,331
Checksum:i93CA5C16F44EEAA0
GO
Isoform 3 (identifier: Q62440-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     79-198: Missing.

Show »
Length:650
Mass (Da):70,258
Checksum:i5FCC67C8B92929C1
GO
Isoform 4 (identifier: Q62440-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     125-198: Missing.
     477-658: Missing.

Show »
Length:514
Mass (Da):55,619
Checksum:i7C36084BE935D848
GO
Isoform 5 (identifier: Q62440-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYH → MFTLSCLFCFP

Show »
Length:740
Mass (Da):79,521
Checksum:iE18B2A843F1F8FE9
GO
Isoform 6 (identifier: Q62440-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     649-653: RQLQQ → NKSYQ
     654-770: Missing.

Show »
Length:653
Mass (Da):70,000
Checksum:i7B72A99D3AFD5716
GO
Isoform 7 (identifier: Q62440-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     193-200: DRESGTSN → GERPGKPD
     201-770: Missing.

Show »
Length:200
Mass (Da):22,439
Checksum:i5DAC9D0AF949D0D7
GO
Isoform 8 (identifier: Q62440-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     127-127: Missing.
     193-200: DRESGTSN → GERPGKPD
     201-770: Missing.

Show »
Length:199
Mass (Da):22,310
Checksum:iE5F799939675DE4C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5SQA2Q5SQA2_MOUSE
Transducin-like enhancer protein 1
Tle1
770Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5SQA3Q5SQA3_MOUSE
Transducin-like enhancer protein 1
Tle1
780Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5SQA5Q5SQA5_MOUSE
Transducin-like enhancer protein 1
Tle1
194Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5SQA4Q5SQA4_MOUSE
Transducin-like enhancer protein 1
Tle1
777Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q2Q6E9Q2Q6_MOUSE
Transducin-like enhancer protein 1
Tle1
770Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5SQA7Q5SQA7_MOUSE
Transducin-like enhancer protein 1
Tle1
167Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti48E → G in AAN77514 (PubMed:12359720).Curated1
Sequence conflicti92V → D in AAB49934 (PubMed:8892234).Curated1
Sequence conflicti122I → T in AAN77518 (PubMed:12359720).Curated1
Sequence conflicti163S → G in AAB49934 (PubMed:8892234).Curated1
Sequence conflicti196S → P (PubMed:8892234).Curated1
Sequence conflicti196S → P in AAN77514 (PubMed:12359720).Curated1
Sequence conflicti196S → P in AAN77518 (PubMed:12359720).Curated1
Sequence conflicti196S → P in BAC35221 (PubMed:16141072).Curated1
Sequence conflicti210S → G (PubMed:8892234).Curated1
Sequence conflicti210S → G in AAN77519 (PubMed:12359720).Curated1
Sequence conflicti210S → G in BAC35221 (PubMed:16141072).Curated1
Sequence conflicti210S → G in BAC38509 (PubMed:16141072).Curated1
Sequence conflicti247V → I in AAN77514 (PubMed:12359720).Curated1
Sequence conflicti258P → S in AAN77514 (PubMed:12359720).Curated1
Sequence conflicti258P → S in AAN77518 (PubMed:12359720).Curated1
Sequence conflicti428R → S in AAN77518 (PubMed:12359720).Curated1
Sequence conflicti464 – 465DA → MP in AAB49934 (PubMed:8892234).Curated2
Sequence conflicti471I → F in AAB49934 (PubMed:8892234).Curated1
Sequence conflicti535S → T in AAB49934 (PubMed:8892234).Curated1
Sequence conflicti542G → D in AAB49934 (PubMed:8892234).Curated1
Sequence conflicti551A → T in AAN77517 (PubMed:12359720).Curated1
Sequence conflicti612F → Y in BAC35221 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0069871 – 41MFPQS…QAQYH → MFTLSCLFCFP in isoform 5. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_00698879 – 198Missing in isoform 3. 1 PublicationAdd BLAST120
Alternative sequenceiVSP_006989125 – 198Missing in isoform 2 and isoform 4. 1 PublicationAdd BLAST74
Alternative sequenceiVSP_006990127Missing in isoform 8. 1 Publication1
Alternative sequenceiVSP_006992193 – 200DRESGTSN → GERPGKPD in isoform 7 and isoform 8. 2 Publications8
Alternative sequenceiVSP_006993201 – 770Missing in isoform 7 and isoform 8. 2 PublicationsAdd BLAST570
Alternative sequenceiVSP_006991477 – 658Missing in isoform 4. CuratedAdd BLAST182
Alternative sequenceiVSP_006994649 – 653RQLQQ → NKSYQ in isoform 6. 1 Publication5
Alternative sequenceiVSP_006995654 – 770Missing in isoform 6. 1 PublicationAdd BLAST117

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U61362 mRNA Translation: AAB49934.1
AY155195 mRNA Translation: AAN77514.1
AY155196 mRNA Translation: AAN77515.1
AY155197 mRNA Translation: AAN77516.1
AY155198 mRNA Translation: AAN77517.1
AY155199 mRNA Translation: AAN77518.1
AY155200 mRNA Translation: AAN77519.1
AK046402 mRNA Translation: BAC32708.1
AK052961 mRNA Translation: BAC35221.1
AK076750 mRNA Translation: BAC36464.1
AK082499 mRNA Translation: BAC38509.1
AL773513 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS18274.1 [Q62440-1]
CCDS71407.1 [Q62440-7]

NCBI Reference Sequences

More...RefSeqi		NP_001272459.1, NM_001285530.1
NP_001272460.1, NM_001285531.1 [Q62440-7]
NP_001272461.1, NM_001285532.1 [Q62440-8]
NP_035729.3, NM_011599.5

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000107337; ENSMUSP00000102960; ENSMUSG00000008305 [Q62440-7]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		21885

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:21885

UCSC genome browser

More...UCSCi		uc008tic.2 mouse [Q62440-1]
uc008tii.3 mouse [Q62440-2]
uc008tij.3 mouse [Q62440-7]
uc008tik.3 mouse [Q62440-8]
uc012dgd.2 mouse [Q62440-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U61362 mRNA Translation: AAB49934.1
AY155195 mRNA Translation: AAN77514.1
AY155196 mRNA Translation: AAN77515.1
AY155197 mRNA Translation: AAN77516.1
AY155198 mRNA Translation: AAN77517.1
AY155199 mRNA Translation: AAN77518.1
AY155200 mRNA Translation: AAN77519.1
AK046402 mRNA Translation: BAC32708.1
AK052961 mRNA Translation: BAC35221.1
AK076750 mRNA Translation: BAC36464.1
AK082499 mRNA Translation: BAC38509.1
AL773513 Genomic DNA No translation available.
CCDSiCCDS18274.1 [Q62440-1]
CCDS71407.1 [Q62440-7]
RefSeqiNP_001272459.1, NM_001285530.1
NP_001272460.1, NM_001285531.1 [Q62440-7]
NP_001272461.1, NM_001285532.1 [Q62440-8]
NP_035729.3, NM_011599.5

3D structure databases

SMRiQ62440
ModBaseiSearch...

Protein-protein interaction databases

BioGridi204216, 11 interactors
CORUMiQ62440
IntActiQ62440, 6 interactors
MINTiQ62440
STRINGi10090.ENSMUSP00000072481

PTM databases

iPTMnetiQ62440
PhosphoSitePlusiQ62440

Proteomic databases

PaxDbiQ62440
PeptideAtlasiQ62440
PRIDEiQ62440

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000107337; ENSMUSP00000102960; ENSMUSG00000008305 [Q62440-7]
GeneIDi21885
KEGGimmu:21885
UCSCiuc008tic.2 mouse [Q62440-1]
uc008tii.3 mouse [Q62440-2]
uc008tij.3 mouse [Q62440-7]
uc008tik.3 mouse [Q62440-8]
uc012dgd.2 mouse [Q62440-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		7088
MGIiMGI:104636 Tle1

Phylogenomic databases

eggNOGiKOG0639 Eukaryota
ENOG410XPX3 LUCA
GeneTreeiENSGT00950000182705
HOGENOMiHOG000293211
InParanoidiQ62440
OrthoDBi546143at2759

Enzyme and pathway databases

ReactomeiR-MMU-201722 Formation of the beta-catenin:TCF transactivating complex
R-MMU-3769402 Deactivation of the beta-catenin transactivating complex
R-MMU-4641265 Repression of WNT target genes

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Tle1 mouse

Protein Ontology

More...PROi		PR:Q62440

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000008305 Expressed in 330 organ(s), highest expression level in rostral migratory stream
ExpressionAtlasiQ62440 baseline and differential
GenevisibleiQ62440 MM

Family and domain databases

Gene3Di2.130.10.10, 1 hit
InterProiView protein in InterPro
IPR005617 Groucho/TLE_N
IPR009146 Groucho_enhance
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PANTHERiPTHR10814 PTHR10814, 1 hit
PfamiView protein in Pfam
PF03920 TLE_N, 1 hit
PF00400 WD40, 2 hits
PRINTSiPR01850 GROUCHOFAMLY
SMARTiView protein in SMART
SM00320 WD40, 7 hits
SUPFAMiSSF50978 SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS00678 WD_REPEATS_1, 2 hits
PS50082 WD_REPEATS_2, 2 hits
PS50294 WD_REPEATS_REGION, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTLE1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q62440
Secondary accession number(s): Q5SQA8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: March 25, 2003
Last modified: May 8, 2019
This is version 177 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again