Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 167 (16 Oct 2019)
Sequence version 2 (16 Aug 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Sorbin and SH3 domain-containing protein 1

Gene

Sorbs1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in tyrosine phosphorylation of CBL by linking CBL to the insulin receptor. Required for insulin-stimulated glucose transport. Involved in formation of actin stress fibers and focal adhesions.3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processTransport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-445355 Smooth Muscle Contraction

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sorbin and SH3 domain-containing protein 1
Alternative name(s):
Ponsin
SH3 domain protein 5
SH3P12
c-Cbl-associated protein
Short name:
CAP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Sorbs1Imported
Synonyms:Kiaa1296Imported, Sh3d51 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:700014 Sorbs1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Cytoskeleton, Membrane, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000721861 – 1290Sorbin and SH3 domain-containing protein 1Add BLAST1290

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei51PhosphothreonineCombined sources1
Modified residuei55PhosphoserineCombined sources1
Modified residuei58PhosphoserineCombined sources1
Modified residuei62PhosphoserineCombined sources1
Modified residuei179PhosphothreonineCombined sources1
Modified residuei185PhosphoserineCombined sources1
Modified residuei204PhosphoserineCombined sources1
Modified residuei209PhosphoserineCombined sources1
Modified residuei254PhosphoserineBy similarity1
Modified residuei261PhosphoserineCombined sources1
Modified residuei270PhosphoserineCombined sources1
Modified residuei325Phosphotyrosine; by ABL11 Publication1
Modified residuei345PhosphoserineCombined sources1
Modified residuei376PhosphoserineCombined sources1
Modified residuei407PhosphoserineCombined sources1
Modified residuei421Phosphotyrosine; by ABL11 Publication1
Modified residuei432PhosphoserineCombined sources1
Modified residuei475PhosphothreonineBy similarity1
Modified residuei969PhosphoserineCombined sources1
Modified residuei1189PhosphothreonineCombined sources1
Modified residuei1193PhosphotyrosineBy similarity1
Modified residuei1198PhosphotyrosineCombined sources1
Modified residuei1201PhosphoserineCombined sources1
Modified residuei1209PhosphoserineCombined sources1
Modified residuei1238Phosphotyrosine; by ABL11 Publication1
Isoform 21 Publication (identifier: Q62417-2)
Modified residuei164PhosphoserineCombined sources1
Modified residuei346PhosphoserineCombined sources1
Isoform 52 Publications (identifier: Q62417-5)
Modified residuei164PhosphoserineCombined sources1
Modified residuei346PhosphoserineCombined sources1
Isoform 6Curated (identifier: Q62417-6)
Modified residuei175PhosphoserineCombined sourcesCurated1
Modified residuei357PhosphoserineCombined sourcesCurated1
Isoform 41 Publication (identifier: Q62417-4)
Modified residuei194PhosphoserineCombined sources1
Modified residuei376PhosphoserineCombined sources1
Isoform 7Curated (identifier: Q62417-7)
Modified residuei288PhosphoserineCombined sourcesCurated1
Modified residuei470PhosphoserineCombined sourcesCurated1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

O-glycosylated.1 Publication

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q62417

PeptideAtlas

More...
PeptideAtlasi
Q62417

PRoteomics IDEntifications database

More...
PRIDEi
Q62417

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q62417

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q62417

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q62417

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in all tissues tested: heart, brain, spleen, lung, liver, muscle, kidney and testis. Expressed in 3T3-L1 adipocytes but not in 3T3-L1 fibroblasts.2 Publications

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via SH3 domain 2) with PXN (By similarity).

Interacts with the long isoform of AFDN and with VCL. AFDN and VCL bind to SORBS1 in a competitive manner and do not form a ternary complex.

Interacts with ABL1, CBL, CBLB and INPPL1/SHIP2 through the third SH3 domain. Interaction with ABL1 occurs only after insulin stimulation while this has no effect on the interaction with INPPL1.

Interacts with the insulin receptor but dissociates from it following insulin stimulation.

Also interacts with SCA7, PTK2/FAK1 and flotillin.

Interacts (via third SH3 domain) with the Ten-1 ICD form of TENM1; the interaction induces the translocation of SORBS1 to the nucleus.

Interacts with INSM1.

By similarity7 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
203213, 16 interactors

Protein interaction database and analysis system

More...
IntActi
Q62417, 15 interactors

Molecular INTeraction database

More...
MINTi
Q62417

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000097066

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q62417

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini202 – 247SoHoPROSITE-ProRule annotationAdd BLAST46
Domaini1049 – 1108SH3 1PROSITE-ProRule annotationAdd BLAST60
Domaini1123 – 1184SH3 2PROSITE-ProRule annotationAdd BLAST62
Domaini1229 – 1290SH3 3PROSITE-ProRule annotationAdd BLAST62

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q62417

KEGG Orthology (KO)

More...
KOi
K06086

Database of Orthologous Groups

More...
OrthoDBi
228183at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q62417

Family and domain databases

Conserved Domains Database

More...
CDDi
cd11919 SH3_Sorbs1_1, 1 hit
cd11922 SH3_Sorbs1_2, 1 hit
cd11916 SH3_Sorbs1_3, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR003127 SoHo_dom
IPR035606 SORBS1_SH3
IPR035610 SORBS1_SH3_1
IPR035611 SORBS1_SH3_2

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00018 SH3_1, 1 hit
PF07653 SH3_2, 1 hit
PF14604 SH3_9, 1 hit
PF02208 Sorb, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00452 SH3DOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00326 SH3, 3 hits
SM00459 Sorb, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50044 SSF50044, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50002 SH3, 3 hits
PS50831 SOHO, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1Curated (identifier: Q62417-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSECDVGSS KAVVNGLASG NHGPDKDMDP TKICTGKGTV TLRASSSYRG
60 70 80 90 100
TPSSSPVSPQ ESPKHESKSG LEPEDPSADE WKLSSSADTN GNAQPSPLAA
110 120 130 140 150
KGYRSVHPSL SADKPQGSPL LNEVSSSHIE TDSQDFPPTS RPSSAYPSTT
160 170 180 190 200
IVNPTIVLLQ HNRDPASERR AGEQDPVPTP AELTSPGRAS ERRAKDASRR
210 220 230 240 250
VVRSAQDLSD VSTDEVGIPL RNTERSKDWY KTMFKQIHKL NRDDDSDVHS
260 270 280 290 300
PRYSFSDDTK SPLSVPRSKS EMNYIEGEKV VKRSATLPLP ARSSSLKSSP
310 320 330 340 350
ERNDWEPLDK KVDTRKYRAE PKSIYEYQPG KSSVLTNEKM SRDISPEEID
360 370 380 390 400
LKNEPWYKFF SELEFGRPTN LEKDLSFCQA ELEADLEKVE TVNKSPSANS
410 420 430 440 450
PQSSAVSPTP DITSEPPGYI YSSNFHAVKR ESDGTPGGLA SLENERQIYK
460 470 480 490 500
SVLEGGDIPL QGLSGLKRPS SSASTKVDRK GGNAHMISSS SVHSRTFHTS
510 520 530 540 550
NALGPGCKHK KPLSAAKACI SEILPSKFKP RLSAPSALLQ EQKSVLLPSE
560 570 580 590 600
KAQSCENLCV SLNDSKRGLP LRVGGSIENL LMRSRRDYDS KSSSTMSLQE
610 620 630 640 650
YGTSSRRPCP LSRKAGLHFS MFYRDMHQIN RAGLSLGSIS SSSVRDLASH
660 670 680 690 700
FERSSLTLAR GELGASQEGS EHIPKHTVSS RITAFEQLIQ RSRSMPSLDF
710 720 730 740 750
SGRLSKSPTP VLSRSGLTSA RSAESLLEST KLRPREMDGM DSGGVYASPT
760 770 780 790 800
CSNMADHALS FRSLVPSEPL SICSDELDHC SNVSNDSREG SGGSVHGDFP
810 820 830 840 850
KHRLNKCKGT CPASYTRFTT IRKHEQQSSR QSDWRSDSRG DKNSLLRNIH
860 870 880 890 900
LMSPLPFRLK KPLQQHPRQP PPSDSSESPA GQKADLPCHD PQDQPHSAGK
910 920 930 940 950
PQVPTRLSSR HTMARLSHNS EPPLDRPAGL EDCTRAINNG NPVPYSDHGL
960 970 980 990 1000
DRNNNPQSEL AAAHGDSESP RHFIPADYLE STEEFIRRRH DDKEKLLADQ
1010 1020 1030 1040 1050
RRLKREQEEA DIAARRHTGV IPTHHQFITN ERFGDLLNID DTAKRKSGLE
1060 1070 1080 1090 1100
MRPARAKFDF KAQTLKELPL QKGDVVYIYR QIDQNWYEGE HHGRVGIFPR
1110 1120 1130 1140 1150
TYIELLPPAE KAQPRKLAPV QVLEYGEAIA KFNFNGDTQV EMSFRKGERI
1160 1170 1180 1190 1200
TLLRQVDENW YEGRIPGTSR QGIFPITYVD VLKRPLVKTP VDYIDLPYSS
1210 1220 1230 1240 1250
SPSRSATVSP QQPQAQQRRV TPDRSQPSLD LCSYQALYSY VPQNDDELEL
1260 1270 1280 1290
RDGDIVDVME KCDDGWFVGT SRRTRQFGTF PGNYVKPLYL
Note: No experimental confirmation available.Curated
Length:1,290
Mass (Da):143,070
Last modified:August 16, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i07C9A74BD794E390
GO
Isoform 21 Publication (identifier: Q62417-2) [UniParc]FASTAAdd to basket
Also known as: CAPsm1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     70-78: Missing.
     163-163: R → REQQKRLSSLS
     341-402: Missing.
     477-965: Missing.

Show »
Length:740
Mass (Da):82,861
Checksum:i9C221599664DB85C
GO
Isoform 31 Publication (identifier: Q62417-3) [UniParc]FASTAAdd to basket
Also known as: Ponsin-21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     70-78: Missing.
     369-402: TNLEKDLSFCQAELEADLEKVETVNKSPSANSPQ → PPKKIWDYTPGDCSILPREDRK
     477-965: Missing.
     994-1049: Missing.

Show »
Length:724
Mass (Da):81,221
Checksum:iFF4207C056D47054
GO
Isoform 41 Publication (identifier: Q62417-4) [UniParc]FASTAAdd to basket
Also known as: Ponsin-11 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     26-26: K → KADPFRARSISAVKIIPVKTVKSPSGLVLPP
     70-78: Missing.
     163-163: R → REQQKRLSSLS
     341-402: Missing.
     477-965: Missing.
     994-1049: Missing.

Show »
Length:714
Mass (Da):79,497
Checksum:iE2804F966844351A
GO
Isoform 52 Publications (identifier: Q62417-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     70-78: Missing.
     163-163: R → REQQKRLSSLS
     341-402: Missing.
     477-965: Missing.
     994-1049: Missing.

Show »
Length:684
Mass (Da):76,370
Checksum:i8451FC615848E3FC
GO
Isoform 6Curated (identifier: Q62417-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     70-78: Missing.
     117-117: G → GATSSSSAPSEG
     163-163: R → REQQKRLSSLS
     341-402: Missing.
     477-965: Missing.
     994-1049: Missing.

Note: No experimental confirmation available.Combined sourcesCurated
Show »
Length:695
Mass (Da):77,332
Checksum:iF48F3C7A8FBC1296
GO
Isoform 7Curated (identifier: Q62417-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     70-78: Missing.
     117-117: G → GATSSSSAPS...DLPGAVSSTG
     163-163: R → REQQKRLSSLS
     341-402: Missing.
     477-965: Missing.
     1212-1290: QPQAQQRRVT...PGNYVKPLYL → VSKLSNSACS...FFSYMSVAFS

Note: No experimental confirmation available.Combined sourcesCurated
Show »
Length:836
Mass (Da):92,037
Checksum:iF00A88619166D705
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3Z5J3D3Z5J3_MOUSE
Sorbin and SH3 domain-containing pr...
Sorbs1
938Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9QNA7E9QNA7_MOUSE
Sorbin and SH3 domain-containing pr...
Sorbs1
740Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A286YCI8A0A286YCI8_MOUSE
Sorbin and SH3 domain-containing pr...
Sorbs1
1,290Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PYX6E9PYX6_MOUSE
Sorbin and SH3 domain-containing pr...
Sorbs1
724Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A286YDN0A0A286YDN0_MOUSE
Sorbin and SH3 domain-containing pr...
Sorbs1
695Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q6A3E9Q6A3_MOUSE
Sorbin and SH3 domain-containing pr...
Sorbs1
714Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A286YCQ0A0A286YCQ0_MOUSE
Sorbin and SH3 domain-containing pr...
Sorbs1
684Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A286YCN8A0A286YCN8_MOUSE
Sorbin and SH3 domain-containing pr...
Sorbs1
170Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A286YD34A0A286YD34_MOUSE
Sorbin and SH3 domain-containing pr...
Sorbs1
126Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A286YDJ3A0A286YDJ3_MOUSE
Sorbin and SH3 domain-containing pr...
Sorbs1
28Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC65769 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti205A → T in BAC28980 (PubMed:16141072).Curated1
Sequence conflicti308L → P in BAC28980 (PubMed:16141072).Curated1
Sequence conflicti1004K → M in AAM77354 (PubMed:15047181).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_05088526K → KADPFRARSISAVKIIPVKT VKSPSGLVLPP in isoform 4. 1 Publication1
Alternative sequenceiVSP_05088670 – 78Missing in isoform 2, isoform 3, isoform 4, isoform 5, isoform 6 and isoform 7. 6 Publications9
Alternative sequenceiVSP_050887117G → GATSSSSAPSEG in isoform 6. 1 Publication1
Alternative sequenceiVSP_050888117G → GATSSSSAPSEVIVVPLYLV NTDRGQGQEGTARTPASLGP LGCVHTVPATTPAASPLTFP TLDDFIPPHLQRRPHHSQPA SACGSLSPASQTSPPSPPPP LVPPVPEDLHRGLEPDLPGA VSSTG in isoform 7. 1 Publication1
Alternative sequenceiVSP_050889163R → REQQKRLSSLS in isoform 2, isoform 4, isoform 5, isoform 6 and isoform 7. 6 Publications1
Alternative sequenceiVSP_050890341 – 402Missing in isoform 2, isoform 4, isoform 5, isoform 6 and isoform 7. 6 PublicationsAdd BLAST62
Alternative sequenceiVSP_050891369 – 402TNLEK…ANSPQ → PPKKIWDYTPGDCSILPRED RK in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_050892477 – 965Missing in isoform 2, isoform 3, isoform 4, isoform 5, isoform 6 and isoform 7. 6 PublicationsAdd BLAST489
Alternative sequenceiVSP_050893994 – 1049Missing in isoform 3, isoform 4, isoform 5 and isoform 6. 4 PublicationsAdd BLAST56
Alternative sequenceiVSP_0508941212 – 1290QPQAQ…KPLYL → VSKLSNSACSFHPQLCQRHT ALLGLLFHALIKSYLEQAGW EFFSYMSVAFS in isoform 7. 1 PublicationAdd BLAST79

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U58883 mRNA Translation: AAC71776.1
AF078666 mRNA Translation: AAD16007.1
AF078667 mRNA Translation: AAD16008.1
AF521593 mRNA Translation: AAM77354.1
AK122487 mRNA Translation: BAC65769.2 Different initiation.
AK035212 mRNA Translation: BAC28980.1
BC012703 mRNA Translation: AAH12703.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS37978.1 [Q62417-3]
CCDS37979.1 [Q62417-2]
CCDS37981.1 [Q62417-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001030134.1, NM_001034962.1
NP_001030135.1, NM_001034963.1
NP_001030136.1, NM_001034964.1

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
20411

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:20411

UCSC genome browser

More...
UCSCi
uc008hkr.1 mouse [Q62417-1]
uc008hks.1 mouse [Q62417-6]
uc008hkt.1 mouse [Q62417-7]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U58883 mRNA Translation: AAC71776.1
AF078666 mRNA Translation: AAD16007.1
AF078667 mRNA Translation: AAD16008.1
AF521593 mRNA Translation: AAM77354.1
AK122487 mRNA Translation: BAC65769.2 Different initiation.
AK035212 mRNA Translation: BAC28980.1
BC012703 mRNA Translation: AAH12703.1
CCDSiCCDS37978.1 [Q62417-3]
CCDS37979.1 [Q62417-2]
CCDS37981.1 [Q62417-4]
RefSeqiNP_001030134.1, NM_001034962.1
NP_001030135.1, NM_001034963.1
NP_001030136.1, NM_001034964.1

3D structure databases

SMRiQ62417
ModBaseiSearch...

Protein-protein interaction databases

BioGridi203213, 16 interactors
IntActiQ62417, 15 interactors
MINTiQ62417
STRINGi10090.ENSMUSP00000097066

PTM databases

iPTMnetiQ62417
PhosphoSitePlusiQ62417
SwissPalmiQ62417

Proteomic databases

jPOSTiQ62417
PeptideAtlasiQ62417
PRIDEiQ62417

Genome annotation databases

GeneIDi20411
KEGGimmu:20411
UCSCiuc008hkr.1 mouse [Q62417-1]
uc008hks.1 mouse [Q62417-6]
uc008hkt.1 mouse [Q62417-7]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10580
MGIiMGI:700014 Sorbs1

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

InParanoidiQ62417
KOiK06086
OrthoDBi228183at2759
PhylomeDBiQ62417

Enzyme and pathway databases

ReactomeiR-MMU-445355 Smooth Muscle Contraction

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Sorbs1 mouse

Protein Ontology

More...
PROi
PR:Q62417

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Family and domain databases

CDDicd11919 SH3_Sorbs1_1, 1 hit
cd11922 SH3_Sorbs1_2, 1 hit
cd11916 SH3_Sorbs1_3, 1 hit
InterProiView protein in InterPro
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR003127 SoHo_dom
IPR035606 SORBS1_SH3
IPR035610 SORBS1_SH3_1
IPR035611 SORBS1_SH3_2
PfamiView protein in Pfam
PF00018 SH3_1, 1 hit
PF07653 SH3_2, 1 hit
PF14604 SH3_9, 1 hit
PF02208 Sorb, 1 hit
PRINTSiPR00452 SH3DOMAIN
SMARTiView protein in SMART
SM00326 SH3, 3 hits
SM00459 Sorb, 1 hit
SUPFAMiSSF50044 SSF50044, 3 hits
PROSITEiView protein in PROSITE
PS50002 SH3, 3 hits
PS50831 SOHO, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSRBS1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q62417
Secondary accession number(s): Q80TF8
, Q8BZI3, Q8K3Y2, Q921F8, Q9Z0Z8, Q9Z0Z9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: August 16, 2004
Last modified: October 16, 2019
This is version 167 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again