Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tumor protein D52

Gene

Tpd52

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-MMU-432722 Golgi Associated Vesicle Biogenesis

Names & Taxonomyi

Protein namesi
Recommended name:
Tumor protein D52
Short name:
mD52
Gene namesi
Name:Tpd52
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 3

Organism-specific databases

MGIiMGI:107749 Tpd52

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001857391 – 224Tumor protein D52Add BLAST224

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei35PhosphothreonineCombined sources1
Modified residuei36PhosphoserineCombined sources1
Modified residuei40PhosphoserineCombined sources1
Modified residuei175PhosphoserineCombined sources1
Modified residuei223PhosphoserineBy similarity1
Isoform 3 (identifier: Q62393-3)
Modified residuei138PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PeptideAtlasiQ62393
PRIDEiQ62393

PTM databases

iPTMnetiQ62393
PhosphoSitePlusiQ62393

Expressioni

Tissue specificityi

Isoform 2 is expressed at higher levels in kidney and brain than in liver, lung, testis and heart. Within the brain, isoform 2 is highly expressed in the granular layer of the cerebellum, the cortex and the hippocampus. In embryos, isoform 2 is expressed in the epithelium of the developing intestine, stomach, olfactory epithelium, neuronal layers of the retina, salivary gland, kidney and dorsal root ganglion.1 Publication

Gene expression databases

BgeeiENSMUSG00000027506 Expressed in 306 organ(s), highest expression level in secondary oocyte
CleanExiMM_TPD52
ExpressionAtlasiQ62393 baseline and differential
GenevisibleiQ62393 MM

Interactioni

Subunit structurei

Forms a homodimer or heterodimer with other members of the family.By similarity

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi204287, 4 interactors
IntActiQ62393, 4 interactors

Structurei

3D structure databases

ProteinModelPortaliQ62393
SMRiQ62393
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili61 – 113Sequence analysisAdd BLAST53

Sequence similaritiesi

Belongs to the TPD52 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

GeneTreeiENSGT00390000015988
HOGENOMiHOG000231968
HOVERGENiHBG058643
InParanoidiQ62393
OMAiMDFYEDY
PhylomeDBiQ62393

Family and domain databases

InterProiView protein in InterPro
IPR007327 TPD52
PANTHERiPTHR19307 PTHR19307, 1 hit
PfamiView protein in Pfam
PF04201 TPD52, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q62393-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MECRDMELAD DYQSPFDFDS GVNKNYLYLS PSGNTSPPGS PTQNVGLLKT
60 70 80 90 100
EPVAEEGEDA VTMLSAPEAL TEEEQEELRR ELTKVEEEIQ TLSQVLAAKE
110 120 130 140 150
KHLAELKRKL GISSLQEFKQ NIAKGWQDVT ATNAYKKTSE TLSQAGQKAS
160 170 180 190 200
AAFSSVGSVI TKKLEDVKNS PTFKSFEEKV ENLKSKVGGA KPAGGDFGEV
210 220
LNSTANATST MTTEPPPEQM TESP
Length:224
Mass (Da):24,313
Last modified:May 26, 2009 - v2
Checksum:iC80D8AB9038B0D73
GO
Isoform 2 (identifier: Q62393-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: MECRDMELADDYQSPFDFDSGVNKNYLYLSPSGNTSPPGSPTQNV → MDRGEQ

Show »
Length:185
Mass (Da):20,059
Checksum:i345B487842135D33
GO
Isoform 3 (identifier: Q62393-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: MECRDMELADDYQSPFDFDSGVNKNYLYLSPSGNTSPPGSPTQNV → MDRGEQ
     168-168: K → NIRSIQHSISMPAMR

Note: No experimental confirmation available.Combined sources
Show »
Length:199
Mass (Da):21,654
Checksum:i7E81DF05305EEB51
GO

Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WHQ1F8WHQ1_MOUSE
Tumor protein D52
Tpd52
247Annotation score:
D3Z7X7D3Z7X7_MOUSE
Tumor protein D52
Tpd52
206Annotation score:
D6RJ37D6RJ37_MOUSE
Tumor protein D52
Tpd52
57Annotation score:
E9PUA7E9PUA7_MOUSE
Tumor protein D52
Tpd52
194Annotation score:
D3Z2U2D3Z2U2_MOUSE
Tumor protein D52
Tpd52
77Annotation score:
D3Z125D3Z125_MOUSE
Tumor protein D52
Tpd52
179Annotation score:
D3Z637D3Z637_MOUSE
MCG10134, isoform CRA_c
Tpd52 mCG_10134
162Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti129V → L in AAH04068 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0373791 – 45MECRD…PTQNV → MDRGEQ in isoform 2 and isoform 3. 3 PublicationsAdd BLAST45
Alternative sequenceiVSP_037380168K → NIRSIQHSISMPAMR in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U44426 mRNA Translation: AAB40897.1
AY048852 mRNA Translation: AAL05266.1
AK005456 mRNA Translation: BAB24048.1
AK032111 mRNA Translation: BAC27709.1
AK151471 mRNA Translation: BAE30428.1
AK151744 mRNA Translation: BAE30655.1
AK152543 mRNA Translation: BAE31298.1
AK153266 mRNA Translation: BAE31856.1
AK153292 mRNA Translation: BAE31875.1
AK161753 mRNA Translation: BAE36558.1
AK168379 mRNA Translation: BAE40308.1
AK168817 mRNA Translation: BAE40644.1
AK169751 mRNA Translation: BAE41345.1
AK170725 mRNA Translation: BAE41982.1
AK171050 mRNA Translation: BAE42212.1
CH466577 Genomic DNA Translation: EDL05193.1
BC002036 mRNA Translation: AAH02036.1
BC004068 mRNA Translation: AAH04068.1
BC094018 mRNA Translation: AAH94018.1
CCDSiCCDS38384.1 [Q62393-3]
CCDS38386.1 [Q62393-1]
CCDS50860.1 [Q62393-2]
RefSeqiNP_001020433.1, NM_001025262.1 [Q62393-1]
NP_001020434.1, NM_001025263.1 [Q62393-3]
NP_033438.1, NM_009412.2 [Q62393-2]
UniGeneiMm.371590

Genome annotation databases

EnsembliENSMUST00000091354; ENSMUSP00000088913; ENSMUSG00000027506 [Q62393-1]
ENSMUST00000091355; ENSMUSP00000088914; ENSMUSG00000027506 [Q62393-3]
ENSMUST00000120143; ENSMUSP00000112830; ENSMUSG00000027506 [Q62393-2]
GeneIDi21985
KEGGimmu:21985
UCSCiuc008oos.1 mouse [Q62393-1]
uc008oot.1 mouse [Q62393-3]
uc008oov.1 mouse [Q62393-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U44426 mRNA Translation: AAB40897.1
AY048852 mRNA Translation: AAL05266.1
AK005456 mRNA Translation: BAB24048.1
AK032111 mRNA Translation: BAC27709.1
AK151471 mRNA Translation: BAE30428.1
AK151744 mRNA Translation: BAE30655.1
AK152543 mRNA Translation: BAE31298.1
AK153266 mRNA Translation: BAE31856.1
AK153292 mRNA Translation: BAE31875.1
AK161753 mRNA Translation: BAE36558.1
AK168379 mRNA Translation: BAE40308.1
AK168817 mRNA Translation: BAE40644.1
AK169751 mRNA Translation: BAE41345.1
AK170725 mRNA Translation: BAE41982.1
AK171050 mRNA Translation: BAE42212.1
CH466577 Genomic DNA Translation: EDL05193.1
BC002036 mRNA Translation: AAH02036.1
BC004068 mRNA Translation: AAH04068.1
BC094018 mRNA Translation: AAH94018.1
CCDSiCCDS38384.1 [Q62393-3]
CCDS38386.1 [Q62393-1]
CCDS50860.1 [Q62393-2]
RefSeqiNP_001020433.1, NM_001025262.1 [Q62393-1]
NP_001020434.1, NM_001025263.1 [Q62393-3]
NP_033438.1, NM_009412.2 [Q62393-2]
UniGeneiMm.371590

3D structure databases

ProteinModelPortaliQ62393
SMRiQ62393
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi204287, 4 interactors
IntActiQ62393, 4 interactors

PTM databases

iPTMnetiQ62393
PhosphoSitePlusiQ62393

Proteomic databases

PeptideAtlasiQ62393
PRIDEiQ62393

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000091354; ENSMUSP00000088913; ENSMUSG00000027506 [Q62393-1]
ENSMUST00000091355; ENSMUSP00000088914; ENSMUSG00000027506 [Q62393-3]
ENSMUST00000120143; ENSMUSP00000112830; ENSMUSG00000027506 [Q62393-2]
GeneIDi21985
KEGGimmu:21985
UCSCiuc008oos.1 mouse [Q62393-1]
uc008oot.1 mouse [Q62393-3]
uc008oov.1 mouse [Q62393-2]

Organism-specific databases

CTDi7163
MGIiMGI:107749 Tpd52

Phylogenomic databases

GeneTreeiENSGT00390000015988
HOGENOMiHOG000231968
HOVERGENiHBG058643
InParanoidiQ62393
OMAiMDFYEDY
PhylomeDBiQ62393

Enzyme and pathway databases

ReactomeiR-MMU-432722 Golgi Associated Vesicle Biogenesis

Miscellaneous databases

PROiPR:Q62393
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000027506 Expressed in 306 organ(s), highest expression level in secondary oocyte
CleanExiMM_TPD52
ExpressionAtlasiQ62393 baseline and differential
GenevisibleiQ62393 MM

Family and domain databases

InterProiView protein in InterPro
IPR007327 TPD52
PANTHERiPTHR19307 PTHR19307, 1 hit
PfamiView protein in Pfam
PF04201 TPD52, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiTPD52_MOUSE
AccessioniPrimary (citable) accession number: Q62393
Secondary accession number(s): Q545M5
, Q8CCU1, Q8K564, Q99KP8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 24, 2001
Last sequence update: May 26, 2009
Last modified: November 7, 2018
This is version 122 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again