Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 127 (08 May 2019)
Sequence version 2 (26 May 2009)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Tumor protein D52

Gene

Tpd52

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-432722 Golgi Associated Vesicle Biogenesis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tumor protein D52
Short name:
mD52
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Tpd52
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:107749 Tpd52

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001857391 – 224Tumor protein D52Add BLAST224

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei35PhosphothreonineCombined sources1
Modified residuei36PhosphoserineCombined sources1
Modified residuei40PhosphoserineCombined sources1
Modified residuei175PhosphoserineCombined sources1
Modified residuei223PhosphoserineBy similarity1
Isoform 3 (identifier: Q62393-3)
Modified residuei138PhosphoserineCombined sources1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q62393

PeptideAtlas

More...
PeptideAtlasi
Q62393

PRoteomics IDEntifications database

More...
PRIDEi
Q62393

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q62393

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q62393

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 2 is expressed at higher levels in kidney and brain than in liver, lung, testis and heart. Within the brain, isoform 2 is highly expressed in the granular layer of the cerebellum, the cortex and the hippocampus. In embryos, isoform 2 is expressed in the epithelium of the developing intestine, stomach, olfactory epithelium, neuronal layers of the retina, salivary gland, kidney and dorsal root ganglion.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000027506 Expressed in 306 organ(s), highest expression level in secondary oocyte

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q62393 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q62393 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms a homodimer or heterodimer with other members of the family.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
204287, 4 interactors

Protein interaction database and analysis system

More...
IntActi
Q62393, 4 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000091943

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q62393

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili61 – 113Sequence analysisAdd BLAST53

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TPD52 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155294

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231968

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q62393

Identification of Orthologs from Complete Genome Data

More...
OMAi
REMDFYE

Database of Orthologous Groups

More...
OrthoDBi
1225782at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q62393

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007327 TPD52

The PANTHER Classification System

More...
PANTHERi
PTHR19307 PTHR19307, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04201 TPD52, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q62393-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MECRDMELAD DYQSPFDFDS GVNKNYLYLS PSGNTSPPGS PTQNVGLLKT
60 70 80 90 100
EPVAEEGEDA VTMLSAPEAL TEEEQEELRR ELTKVEEEIQ TLSQVLAAKE
110 120 130 140 150
KHLAELKRKL GISSLQEFKQ NIAKGWQDVT ATNAYKKTSE TLSQAGQKAS
160 170 180 190 200
AAFSSVGSVI TKKLEDVKNS PTFKSFEEKV ENLKSKVGGA KPAGGDFGEV
210 220
LNSTANATST MTTEPPPEQM TESP
Length:224
Mass (Da):24,313
Last modified:May 26, 2009 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC80D8AB9038B0D73
GO
Isoform 2 (identifier: Q62393-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: MECRDMELADDYQSPFDFDSGVNKNYLYLSPSGNTSPPGSPTQNV → MDRGEQ

Show »
Length:185
Mass (Da):20,059
Checksum:i345B487842135D33
GO
Isoform 3 (identifier: Q62393-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: MECRDMELADDYQSPFDFDSGVNKNYLYLSPSGNTSPPGSPTQNV → MDRGEQ
     168-168: K → NIRSIQHSISMPAMR

Note: No experimental confirmation available.Combined sources
Show »
Length:199
Mass (Da):21,654
Checksum:i7E81DF05305EEB51
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WHQ1F8WHQ1_MOUSE
Tumor protein D52
Tpd52
247Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PUA7E9PUA7_MOUSE
Tumor protein D52
Tpd52
194Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z125D3Z125_MOUSE
Tumor protein D52
Tpd52
179Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z7X7D3Z7X7_MOUSE
Tumor protein D52
Tpd52
206Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z637D3Z637_MOUSE
MCG10134, isoform CRA_c
Tpd52 mCG_10134
162Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RJ37D6RJ37_MOUSE
Tumor protein D52
Tpd52
57Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z2U2D3Z2U2_MOUSE
Tumor protein D52
Tpd52
77Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti129V → L in AAH04068 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0373791 – 45MECRD…PTQNV → MDRGEQ in isoform 2 and isoform 3. 3 PublicationsAdd BLAST45
Alternative sequenceiVSP_037380168K → NIRSIQHSISMPAMR in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U44426 mRNA Translation: AAB40897.1
AY048852 mRNA Translation: AAL05266.1
AK005456 mRNA Translation: BAB24048.1
AK032111 mRNA Translation: BAC27709.1
AK151471 mRNA Translation: BAE30428.1
AK151744 mRNA Translation: BAE30655.1
AK152543 mRNA Translation: BAE31298.1
AK153266 mRNA Translation: BAE31856.1
AK153292 mRNA Translation: BAE31875.1
AK161753 mRNA Translation: BAE36558.1
AK168379 mRNA Translation: BAE40308.1
AK168817 mRNA Translation: BAE40644.1
AK169751 mRNA Translation: BAE41345.1
AK170725 mRNA Translation: BAE41982.1
AK171050 mRNA Translation: BAE42212.1
CH466577 Genomic DNA Translation: EDL05193.1
BC002036 mRNA Translation: AAH02036.1
BC004068 mRNA Translation: AAH04068.1
BC094018 mRNA Translation: AAH94018.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS38384.1 [Q62393-3]
CCDS38386.1 [Q62393-1]
CCDS50860.1 [Q62393-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001020433.1, NM_001025262.1 [Q62393-1]
NP_001020434.1, NM_001025263.1 [Q62393-3]
NP_033438.1, NM_009412.2 [Q62393-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000091354; ENSMUSP00000088913; ENSMUSG00000027506 [Q62393-1]
ENSMUST00000091355; ENSMUSP00000088914; ENSMUSG00000027506 [Q62393-3]
ENSMUST00000120143; ENSMUSP00000112830; ENSMUSG00000027506 [Q62393-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
21985

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:21985

UCSC genome browser

More...
UCSCi
uc008oos.1 mouse [Q62393-1]
uc008oot.1 mouse [Q62393-3]
uc008oov.1 mouse [Q62393-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U44426 mRNA Translation: AAB40897.1
AY048852 mRNA Translation: AAL05266.1
AK005456 mRNA Translation: BAB24048.1
AK032111 mRNA Translation: BAC27709.1
AK151471 mRNA Translation: BAE30428.1
AK151744 mRNA Translation: BAE30655.1
AK152543 mRNA Translation: BAE31298.1
AK153266 mRNA Translation: BAE31856.1
AK153292 mRNA Translation: BAE31875.1
AK161753 mRNA Translation: BAE36558.1
AK168379 mRNA Translation: BAE40308.1
AK168817 mRNA Translation: BAE40644.1
AK169751 mRNA Translation: BAE41345.1
AK170725 mRNA Translation: BAE41982.1
AK171050 mRNA Translation: BAE42212.1
CH466577 Genomic DNA Translation: EDL05193.1
BC002036 mRNA Translation: AAH02036.1
BC004068 mRNA Translation: AAH04068.1
BC094018 mRNA Translation: AAH94018.1
CCDSiCCDS38384.1 [Q62393-3]
CCDS38386.1 [Q62393-1]
CCDS50860.1 [Q62393-2]
RefSeqiNP_001020433.1, NM_001025262.1 [Q62393-1]
NP_001020434.1, NM_001025263.1 [Q62393-3]
NP_033438.1, NM_009412.2 [Q62393-2]

3D structure databases

SMRiQ62393
ModBaseiSearch...

Protein-protein interaction databases

BioGridi204287, 4 interactors
IntActiQ62393, 4 interactors
STRINGi10090.ENSMUSP00000091943

PTM databases

iPTMnetiQ62393
PhosphoSitePlusiQ62393

Proteomic databases

jPOSTiQ62393
PeptideAtlasiQ62393
PRIDEiQ62393

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000091354; ENSMUSP00000088913; ENSMUSG00000027506 [Q62393-1]
ENSMUST00000091355; ENSMUSP00000088914; ENSMUSG00000027506 [Q62393-3]
ENSMUST00000120143; ENSMUSP00000112830; ENSMUSG00000027506 [Q62393-2]
GeneIDi21985
KEGGimmu:21985
UCSCiuc008oos.1 mouse [Q62393-1]
uc008oot.1 mouse [Q62393-3]
uc008oov.1 mouse [Q62393-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
7163
MGIiMGI:107749 Tpd52

Phylogenomic databases

GeneTreeiENSGT00940000155294
HOGENOMiHOG000231968
InParanoidiQ62393
OMAiREMDFYE
OrthoDBi1225782at2759
PhylomeDBiQ62393

Enzyme and pathway databases

ReactomeiR-MMU-432722 Golgi Associated Vesicle Biogenesis

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q62393

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000027506 Expressed in 306 organ(s), highest expression level in secondary oocyte
ExpressionAtlasiQ62393 baseline and differential
GenevisibleiQ62393 MM

Family and domain databases

InterProiView protein in InterPro
IPR007327 TPD52
PANTHERiPTHR19307 PTHR19307, 1 hit
PfamiView protein in Pfam
PF04201 TPD52, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTPD52_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q62393
Secondary accession number(s): Q545M5
, Q8CCU1, Q8K564, Q99KP8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 24, 2001
Last sequence update: May 26, 2009
Last modified: May 8, 2019
This is version 127 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again