Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 137 (16 Oct 2019)
Sequence version 4 (16 Oct 2013)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Phosphatidylethanolamine N-methyltransferase

Gene

Pemt

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the three sequential steps of the methylation pathway of phosphatidylcholine biosynthesis, the SAM-dependent methylation of phosphatidylethanolamine (PE) to phosphatidylmonomethylethanolamine (PMME), PMME to phosphatidyldimethylethanolamine (PDME), and PDME to phosphatidylcholine (PC).UniRule annotation2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: phosphatidylcholine biosynthesis

This protein is involved in the pathway phosphatidylcholine biosynthesis, which is part of Phospholipid metabolism.UniRule annotation
View all proteins of this organism that are known to be involved in the pathway phosphatidylcholine biosynthesis and in Phospholipid metabolism.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMethyltransferase, Transferase
Biological processLipid biosynthesis, Lipid metabolism, Phospholipid biosynthesis, Phospholipid metabolism
LigandS-adenosyl-L-methionine

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.1.1.17 3474

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-1483191 Synthesis of PC

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00753

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Phosphatidylethanolamine N-methyltransferaseUniRule annotation (EC:2.1.1.17UniRule annotation, EC:2.1.1.71UniRule annotation)
Short name:
PEAMTUniRule annotation
Short name:
PEMTUniRule annotation
Alternative name(s):
Phospholipid methyltransferaseUniRule annotation
Short name:
PLMTUniRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PemtUniRule annotation
Synonyms:Pempt, Pemt2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:104535 Pemt

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 12LumenalUniRule annotationAdd BLAST12
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a region that is buried within a membrane, but does not cross it.<p><a href='/help/intramem' target='_top'>More...</a></p>Intramembranei13 – 33HelicalUniRule annotationAdd BLAST21
Topological domaini34 – 45LumenalUniRule annotationAdd BLAST12
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei46 – 66HelicalUniRule annotationAdd BLAST21
Topological domaini67 – 93CytoplasmicUniRule annotationAdd BLAST27
Transmembranei94 – 114HelicalUniRule annotationAdd BLAST21
Topological domaini115 – 157LumenalUniRule annotationAdd BLAST43
Transmembranei158 – 178HelicalUniRule annotationAdd BLAST21
Topological domaini179 – 199CytoplasmicUniRule annotationAdd BLAST21

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Mitochondrion

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001939211 – 199Phosphatidylethanolamine N-methyltransferaseAdd BLAST199

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q61907

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q61907

PRoteomics IDEntifications database

More...
PRIDEi
Q61907

PTM databases

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q61907

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Liver.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000000301 Expressed in 91 organ(s), highest expression level in morula

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q61907 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q61907 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q61907, 2 interactors

Molecular INTeraction database

More...
MINTi
Q61907

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000099753

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni98 – 100S-adenosyl-L-methionine bindingUniRule annotation3
Regioni180 – 181S-adenosyl-L-methionine bindingUniRule annotation2

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the class VI-like SAM-binding methyltransferase superfamily. PEMT/PEM2 methyltransferase family.UniRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4142 Eukaryota
ENOG4111HY0 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000007041

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000208789

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q61907

KEGG Orthology (KO)

More...
KOi
K00551

Identification of Orthologs from Complete Genome Data

More...
OMAi
FNPTFWN

Database of Orthologous Groups

More...
OrthoDBi
1395721at2759

TreeFam database of animal gene trees

More...
TreeFami
TF300198

Family and domain databases

HAMAP database of protein families

More...
HAMAPi
MF_03216 PLMT, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR024960 PEMT/MFAP
IPR007318 Phopholipid_MeTrfase

The PANTHER Classification System

More...
PANTHERi
PTHR15458 PTHR15458, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04191 PEMT, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF005444 PEMT, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51599 SAM_PEMT_PEM2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q61907-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSWLLGYMDP TEPSFVAAVI TIVFNPLFWN VVARWEQRTR KLSRAFGSPH
60 70 80 90 100
LACYSLGICI LLLNILRSHC FTQAMMSQPK MEGLDNHTTY FLGLAFLGWG
110 120 130 140 150
FVFVLSSFYA LGFTGTFLGD YFGILKESRV TTFPFSVLDN PMYWGSTANY
160 170 180 190
LGWALMHASP TGLLLTVLVA IVYVVALLYE EPFTAEIYRQ KATRLHKRS
Length:199
Mass (Da):22,579
Last modified:October 16, 2013 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0F96C1CC3B483DC6
GO
Isoform 2 (identifier: Q61907-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEENTSPTTALISSSVAGHDCCGGFGNIDFRQADLFVM

Show »
Length:236
Mass (Da):26,453
Checksum:i8D321A6CA1C51849
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1ARD1B1ARD1_MOUSE
Phosphatidylethanolamine N-methyltr...
Pemt
128Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1ARC9B1ARC9_MOUSE
Phosphatidylethanolamine N-methyltr...
Pemt
105Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAQ01190 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti168L → V in AAA67686 (PubMed:8978486).Curated1
Sequence conflicti173Y → N in AAA67686 (PubMed:8978486).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0532241M → MEENTSPTTALISSSVAGHD CCGGFGNIDFRQADLFVM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U25051
, U25046, U25047, U25048, U25049, U25050 Genomic DNA Translation: AAA67686.1
AY334571 mRNA Translation: AAQ01190.1 Frameshift.
AK133744 mRNA Translation: BAE21818.1
AL603710 Genomic DNA No translation available.
AL645526 Genomic DNA No translation available.
BC026796 mRNA Translation: AAH26796.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS24782.1 [Q61907-1]
CCDS78957.1 [Q61907-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001276940.1, NM_001290011.1 [Q61907-2]
NP_001276941.1, NM_001290012.1 [Q61907-1]
NP_001276942.1, NM_001290013.1 [Q61907-1]
NP_001276943.1, NM_001290014.1
NP_032845.2, NM_008819.3 [Q61907-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000000310; ENSMUSP00000000310; ENSMUSG00000000301 [Q61907-1]
ENSMUST00000102692; ENSMUSP00000099753; ENSMUSG00000000301 [Q61907-1]
ENSMUST00000102693; ENSMUSP00000099754; ENSMUSG00000000301 [Q61907-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
18618

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:18618

UCSC genome browser

More...
UCSCi
uc007jfi.2 mouse [Q61907-1]
uc007jfj.2 mouse [Q61907-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U25051
, U25046, U25047, U25048, U25049, U25050 Genomic DNA Translation: AAA67686.1
AY334571 mRNA Translation: AAQ01190.1 Frameshift.
AK133744 mRNA Translation: BAE21818.1
AL603710 Genomic DNA No translation available.
AL645526 Genomic DNA No translation available.
BC026796 mRNA Translation: AAH26796.1
CCDSiCCDS24782.1 [Q61907-1]
CCDS78957.1 [Q61907-2]
RefSeqiNP_001276940.1, NM_001290011.1 [Q61907-2]
NP_001276941.1, NM_001290012.1 [Q61907-1]
NP_001276942.1, NM_001290013.1 [Q61907-1]
NP_001276943.1, NM_001290014.1
NP_032845.2, NM_008819.3 [Q61907-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

IntActiQ61907, 2 interactors
MINTiQ61907
STRINGi10090.ENSMUSP00000099753

PTM databases

SwissPalmiQ61907

Proteomic databases

jPOSTiQ61907
PaxDbiQ61907
PRIDEiQ61907

Genome annotation databases

EnsembliENSMUST00000000310; ENSMUSP00000000310; ENSMUSG00000000301 [Q61907-1]
ENSMUST00000102692; ENSMUSP00000099753; ENSMUSG00000000301 [Q61907-1]
ENSMUST00000102693; ENSMUSP00000099754; ENSMUSG00000000301 [Q61907-2]
GeneIDi18618
KEGGimmu:18618
UCSCiuc007jfi.2 mouse [Q61907-1]
uc007jfj.2 mouse [Q61907-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10400
MGIiMGI:104535 Pemt

Phylogenomic databases

eggNOGiKOG4142 Eukaryota
ENOG4111HY0 LUCA
GeneTreeiENSGT00390000007041
HOGENOMiHOG000208789
InParanoidiQ61907
KOiK00551
OMAiFNPTFWN
OrthoDBi1395721at2759
TreeFamiTF300198

Enzyme and pathway databases

UniPathwayiUPA00753
BRENDAi2.1.1.17 3474
ReactomeiR-MMU-1483191 Synthesis of PC

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Pemt mouse

Protein Ontology

More...
PROi
PR:Q61907

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000000301 Expressed in 91 organ(s), highest expression level in morula
ExpressionAtlasiQ61907 baseline and differential
GenevisibleiQ61907 MM

Family and domain databases

HAMAPiMF_03216 PLMT, 1 hit
InterProiView protein in InterPro
IPR024960 PEMT/MFAP
IPR007318 Phopholipid_MeTrfase
PANTHERiPTHR15458 PTHR15458, 1 hit
PfamiView protein in Pfam
PF04191 PEMT, 1 hit
PIRSFiPIRSF005444 PEMT, 1 hit
PROSITEiView protein in PROSITE
PS51599 SAM_PEMT_PEM2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPEMT_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q61907
Secondary accession number(s): Q3UZN8, Q7TNW6, Q8R0I1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: October 16, 2013
Last modified: October 16, 2019
This is version 137 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again