UniProtKB - Q61595 (KTN1_MOUSE)

BLAST

>sp|Q61595|KTN1_MOUSE Kinectin OS=Mus musculus OX=10090 GN=Ktn1 PE=1 SV=1
MELYESTYFIVLIPSVVITVIFLFFWLFMKETLYDEVLAKQKREQKLISTKTDKKKAEKK
KNKKKEIQNGTLRESDSEHVPRDFKLSDASPAEDEQFVPAPLNVAETSSSVRERQKKEKK
QKPSLEEQVIKESDASKIPGKKVEPVLVTKQPAPPPPLEAAALKKKAGQKKSKNGSEEQD
KKVEMLMAPSKEQDVLLSHQDTKQEGGLGKKKGLSKKQKSENVAVLVDEPLIHATTYMPL
DNANSNLMMDKREIIDMIKPDHVEGIQKSGTKKLKIETDKENAEVKFKDFLLSLKTMMFS
EDEALCVVDLLKEKSGVIKEALKKSNKGELSGLLHQLQEKERLLSAMKEDAAASKERCKR
LTQEMMTEKERSSVVIARMKDRIGTLEKEHNIFQNKMHASYQETQQMQMKFQQVQEQMEA
EIAHLKQENGILRDAVSNTTNQLESKQSAELNKLRQDCGRLVSELNEKTGKLQQEGVQKK
NAEQAATQLKVQLQEAERRWEEVQSYIRKRTAEHEAAQQDLQSKFVAKENEVQSLHSKLT
DTLVSKQQLEQRLMQLMESEQKRASKEESLQIQVQDILEQNEALKAQIQQFHSQIAAQTS
ASVLAEELHKVIAEKDKQLKQTEDSLANEQDHLASKEEELKDVQNMNFLLKAEVQKWQAL
ANEQAATAHEVEKMQKSIHVKEDEIRLLEEQLQHEVASKMEELKILSEQNKALQSEVRKL
QTAVSQQPNKDVVEQMEKCIQEKDEKLRTVEELLETGLIQVATREEELSAIRTENSTLTR
EVQELKAKQSDQVSFVSLIEDLKRVIHEKDGQIKSVEELLEVELLKVANKEKTVQALKQE
IEVLKEEIGNAQLEKAHQLSVTSQVQELQNLLRGKEEQVNSMKAALEDRDRGLTGRGTCA
QVCSTPQFEELESVLKEKDNEIKRIEVKLKDTESDVSKMSELLKEVQEENKFLKCQLSHQ
KHQQASFPSQEELQTVISEKEKEITDLCNELESLKNAVEHQRKKNNDLREKNWEAMEALA
STEKMLQDRVNKTSKERRQHVEAIELESKDLLKRLFPTVSVPSNLNYSEWLRGFEKKAKA
CVAGTSDAEAVKVLEHRLKEASEMHTLLQLECEKYKSVLAETEGILQKLQRSVEQEESKW
KIKADESQRMIKQMQSSFTASERELERLRQENKDMENLRREREHLEMELEKAEMERSTYV
MEVRELKDLLTELQKKLDDSYSEAVRQNEELNLLKTQLNETHSKLQNEQTERKKVADDLH
KAQQSLNSIHSKISLKAAGDTVVIENSDISPEMESPEKETMSVSLNQTVTQLQQLLQEVN
QQLTKET

Align

Format
Add to basket Added to basket
History
Entry version 114 (12 Sep 2018)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Kinectin

Gene

Ktn1

Organism

Mus musculus (Mouse)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Receptor for kinesin thus involved in kinesin-driven vesicle motility. Accumulates in integrin-based adhesion complexes (IAC) upon integrin aggregation by fibronectin (By similarity).By similarity

GO - Molecular functionⁱ

kinesin binding
Source: MGI
Traceable author statementⁱ
- 11486041

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

microtubule-based movement
Source: MGI
Traceable author statementⁱ
- 11486041

View the complete GO annotation on QuickGO ...

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Kinectin
Gene namesⁱ	Name:Ktn1Imported
Organismⁱ	Mus musculus (Mouse)
Taxonomic identifierⁱ	10090 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
Proteomesⁱ	UP000000589 Componentⁱ: Unplaced

Organism-specific databases

MGIⁱ	MGI:109153 Ktn1

Topology

Feature key	Position(s)	DescriptionActions	Length
Topological domainⁱ	1 – 8	CytoplasmicSequence analysis	8
Transmembraneⁱ	9 – 29	Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST	21
Topological domainⁱ	30 – 1327	LumenalSequence analysisAdd BLAST	1298

Keywords - Cellular componentⁱ

Endoplasmic reticulum, Membrane

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000238620	1 – 1327	KinectinAdd BLAST		1327

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Glycosylationⁱ	69	N-linked (GlcNAc...) asparagineSequence analysis	1
Modified residueⁱ	75	PhosphoserineBy similarity	1
Modified residueⁱ	77	PhosphoserineBy similarity	1
Glycosylationⁱ	1031	N-linked (GlcNAc...) asparagineSequence analysis	1
Modified residueⁱ	1060	PhosphoserineBy similarity	1
Glycosylationⁱ	1066	N-linked (GlcNAc...) asparagineSequence analysis	1
Modified residueⁱ	1290	PhosphoserineBy similarity	1

Keywords - PTMⁱ

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbⁱ	Q61595
PeptideAtlas More...PeptideAtlasⁱ	Q61595
PRIDEⁱ	Q61595

PTM databases

iPTMnetⁱ	Q61595
PhosphoSitePlusⁱ	Q61595
SwissPalmⁱ	Q61595

Expressionⁱ

Tissue specificityⁱ

Expressed in all tissues examined including 12-day embryo, adult heart, brain, ovary, kidney, lung, small intestine, spleen, thymus and pancreas.1 Publication

Developmental stageⁱ

Isoform 6, isoform 7 and isoform 8 are detected in embryonic hippocampus but not in later developmental stages. Isoform 14, isoform 15 and isoform 16 are adult-specific.1 Publication

Gene expression databases

CleanExⁱ	MM_KTN1

CleanExⁱ

MM_KTN1

Interactionⁱ

GO - Molecular functionⁱ

kinesin binding
Source: MGI
Traceable author statementⁱ
- 11486041

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	201049, 78 interactors
IntActⁱ	Q61595, 7 interactors
Molecular INTeraction database More...MINTⁱ	Q61595
STRINGⁱ	10090.ENSMUSP00000022391

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	Q61595
SMRⁱ	Q61595
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Coiled coil

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Coiled coilⁱ	329 – 1327	Sequence analysisAdd BLAST		999

Compositional bias

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Compositional biasⁱ	40 – 219	Lys-richSequence analysisAdd BLAST		180

Sequence similaritiesⁱ

Belongs to the kinectin family.Sequence analysis

Keywords - Domainⁱ

Coiled coil, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGⁱ	ENOG410IIAW Eukaryota ENOG410YAE3 LUCA
HOVERGENⁱ	HBG007851
InParanoidⁱ	Q61595
KEGG Orthology (KO) More...KOⁱ	K17975
PhylomeDBⁱ	Q61595

Family and domain databases

InterProⁱ	View protein in InterPro IPR024854 Kinectin
PANTHERⁱ	PTHR18864 PTHR18864, 1 hit

Sequences (16+)ⁱ

Sequence statusⁱ: Complete.

This entry describes 16 isoformsⁱ produced by alternative splicing. Align Add to basket

This entry has 16 described isoforms and 19 potential isoforms that are computationally mapped.ⁱShow all

Isoform 11 Publication (identifier: Q61595-1) [UniParc]FASTA Add to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

	Entry	Entry name	Protein names	Gene names	Length	Annotation
	F8VQC7	F8VQC7_MOUSE	Kinectin Kinectin	Ktn1	1,327	Annotation score:
	A0A087WP85	A0A087WP85_MOUSE	Kinectin Kinectin	Ktn1	1,275	Annotation score:
	A0A087WP14	A0A087WP14_MOUSE	Kinectin Kinectin	Ktn1	1,280	Annotation score:
	A0A087WQQ5	A0A087WQQ5_MOUSE	Kinectin Kinectin	Ktn1	1,275	Annotation score:
	A0A087WS29	A0A087WS29_MOUSE	Kinectin Kinectin	Ktn1	1,228	Annotation score:
	A0A087WPX0	A0A087WPX0_MOUSE	Kinectin Kinectin	Ktn1	1,304	Annotation score:
	A0A087WQF8	A0A087WQF8_MOUSE	Kinectin Kinectin	Ktn1	1,200	Annotation score:
	A0A087WNW3	A0A087WNW3_MOUSE	Kinectin Kinectin	Ktn1	1,247	Annotation score:
	A0A087WRS1	A0A087WRS1_MOUSE	Kinectin Kinectin	Ktn1	1,275	Annotation score:
	A0A087WQ25	A0A087WQ25_MOUSE	Kinectin Kinectin	Ktn1	1,270	Annotation score:
There are more potential isoformsShow all

Feature key	Position(s)	DescriptionActions	Length
Sequence conflictⁱ	10	I → V in BAC30538 (PubMed:16141072).Curated	1
Sequence conflictⁱ	115	Q → K in BAC30538 (PubMed:16141072).Curated	1
Sequence conflictⁱ	178	Missing (PubMed:16141072).Curated	1
Sequence conflictⁱ	238	M → I (PubMed:16141072).Curated	1
Sequence conflictⁱ	360	R → Q (PubMed:16141072).Curated	1
Sequence conflictⁱ	1118	V → VS in CAD56927 (PubMed:15316074).Curated	1
Sequence conflictⁱ	1183	E → G in CAD56935 (PubMed:15316074).Curated	1
Sequence conflictⁱ	1238	L → F in CAD56936 (PubMed:15316074).Curated	1

Feature key	Position(s)	DescriptionActions	Length
Alternative sequenceⁱVSP_052042	836 – 858	Missing in isoform 2, isoform 3, isoform 4, isoform 7, isoform 8, isoform 10, isoform 11, isoform 12, isoform 13, isoform 14 and isoform 16. 1 PublicationAdd BLAST	23
Alternative sequenceⁱVSP_052043	1007 – 1035	Missing in isoform 2, isoform 3, isoform 4, isoform 5, isoform 6, isoform 10, isoform 12 and isoform 16. 1 PublicationAdd BLAST	29
Alternative sequenceⁱVSP_052044	1154 – 1177	Missing in isoform 2, isoform 3, isoform 7, isoform 8, isoform 9, isoform 12, isoform 14 and isoform 15. 1 PublicationAdd BLAST	24
Alternative sequenceⁱVSP_052045	1208 – 1235	Missing in isoform 2, isoform 4, isoform 6, isoform 8, isoform 9, isoform 12, isoform 13, isoform 14, isoform 15 and isoform 16. 1 PublicationAdd BLAST	28
Alternative sequenceⁱVSP_052046	1294 – 1327	ESPEK…LTKET → SEVIGKLLVRS in isoform 2, isoform 3, isoform 5, isoform 6, isoform 9, isoform 13, isoform 14 and isoform 16. 1 PublicationAdd BLAST	34

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	L43326 mRNA Translation: AAB65839.1 AK040200 mRNA Translation: BAC30538.1 AJ517365 mRNA Translation: CAD56924.1 AJ517366 mRNA Translation: CAD56925.1 AJ517367 mRNA Translation: CAD56926.1 AJ517368 mRNA Translation: CAD56927.1 AJ517369 mRNA Translation: CAD56928.1 AJ517370 mRNA Translation: CAD56929.1 AJ517371 mRNA Translation: CAD56930.1 AJ517372 mRNA Translation: CAD56931.1 AJ517373 mRNA Translation: CAD56932.1 AJ517374 mRNA Translation: CAD56933.1 AJ517375 mRNA Translation: CAD56934.1 AJ517376 mRNA Translation: CAD56935.1 AJ517377 mRNA Translation: CAD56936.1 AJ517378 mRNA Translation: CAD56937.1 AJ517379 mRNA Translation: CAD56938.1 AJ517380 mRNA Translation: CAD56939.1 AJ517381 mRNA Translation: CAD56940.1 AJ517382 mRNA Translation: CAD56941.1 AJ517383 mRNA Translation: CAD56942.1 AJ517384 mRNA Translation: CAD56943.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS36900.1 [Q61595-1] CCDS84123.1 [Q61595-9] CCDS84124.1 [Q61595-5] CCDS84125.1 [Q61595-6] CCDS84126.1 [Q61595-11] CCDS84127.1 [Q61595-13] CCDS84130.1 [Q61595-14] CCDS84132.1 [Q61595-4] CCDS84133.1 [Q61595-16] CCDS84135.1 [Q61595-12] CCDS84136.1 [Q61595-2]
NCBI Reference Sequences More...RefSeqⁱ	NP_001280564.1, NM_001293635.1 NP_001280565.1, NM_001293636.1 NP_001334448.1, NM_001347519.1 NP_001334449.1, NM_001347520.1 NP_001334450.1, NM_001347521.1 NP_001334452.1, NM_001347523.1 NP_001334453.1, NM_001347524.1 NP_001334454.1, NM_001347525.1 NP_001334455.1, NM_001347526.1 NP_001334456.1, NM_001347527.1 NP_001334457.1, NM_001347528.1 NP_032503.2, NM_008477.2
UniGeneⁱ	Mm.3110

Entry nameⁱ	KTN1_MOUSE
Accessionⁱ	Q61595Primary (citable) accession number: Q61595 Secondary accession number(s): Q8BG49 Q8CG63
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	May 30, 2006
	Last sequence update:	November 1, 1996
	Last modified:	September 12, 2018
	This is version 114 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q61595 (KTN1_MOUSE)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Kinectin

Ktn1

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Endoplasmic reticulum

Endoplasmic reticulum

Other locations

Topology

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Compositional bias

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Computationally mapped potential isoform sequencesi

Experimental Info

Alternative sequence

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Computationally mapped potential isoform sequencesⁱ

Keywords - Coding sequence diversityⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ