Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 119 (16 Oct 2019)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Kinectin

Gene

Ktn1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Receptor for kinesin thus involved in kinesin-driven vesicle motility. Accumulates in integrin-based adhesion complexes (IAC) upon integrin aggregation by fibronectin (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • kinesin binding Source: MGI

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
R-MMU-5625970 RHO GTPases activate KTN1
R-MMU-8957275 Post-translational protein phosphorylation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Kinectin
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ktn1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:109153 Ktn1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 8CytoplasmicSequence analysis8
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei9 – 29Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini30 – 1327LumenalSequence analysisAdd BLAST1298

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002386201 – 1327KinectinAdd BLAST1327

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi69N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei75PhosphoserineBy similarity1
Modified residuei77PhosphoserineBy similarity1
Glycosylationi1031N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei1060PhosphoserineBy similarity1
Glycosylationi1066N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei1290PhosphoserineBy similarity1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q61595

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q61595

PeptideAtlas

More...
PeptideAtlasi
Q61595

PRoteomics IDEntifications database

More...
PRIDEi
Q61595

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q61595

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q61595

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q61595

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in all tissues examined including 12-day embryo, adult heart, brain, ovary, kidney, lung, small intestine, spleen, thymus and pancreas.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Isoform 6, isoform 7 and isoform 8 are detected in embryonic hippocampus but not in later developmental stages. Isoform 14, isoform 15 and isoform 16 are adult-specific.1 Publication

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
201049, 80 interactors

Protein interaction database and analysis system

More...
IntActi
Q61595, 8 interactors

Molecular INTeraction database

More...
MINTi
Q61595

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000140324

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q61595

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili329 – 1327Sequence analysisAdd BLAST999

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi40 – 219Lys-richSequence analysisAdd BLAST180

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the kinectin family.Sequence analysis

Keywords - Domaini

Coiled coil, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IIAW Eukaryota
ENOG410YAE3 LUCA

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q61595

KEGG Orthology (KO)

More...
KOi
K17975

Database of Orthologous Groups

More...
OrthoDBi
327650at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q61595

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR024854 Kinectin

The PANTHER Classification System

More...
PANTHERi
PTHR18864 PTHR18864, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (16+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 16 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 16 described isoforms and 19 potential isoforms that are computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: Q61595-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MELYESTYFI VLIPSVVITV IFLFFWLFMK ETLYDEVLAK QKREQKLIST
60 70 80 90 100
KTDKKKAEKK KNKKKEIQNG TLRESDSEHV PRDFKLSDAS PAEDEQFVPA
110 120 130 140 150
PLNVAETSSS VRERQKKEKK QKPSLEEQVI KESDASKIPG KKVEPVLVTK
160 170 180 190 200
QPAPPPPLEA AALKKKAGQK KSKNGSEEQD KKVEMLMAPS KEQDVLLSHQ
210 220 230 240 250
DTKQEGGLGK KKGLSKKQKS ENVAVLVDEP LIHATTYMPL DNANSNLMMD
260 270 280 290 300
KREIIDMIKP DHVEGIQKSG TKKLKIETDK ENAEVKFKDF LLSLKTMMFS
310 320 330 340 350
EDEALCVVDL LKEKSGVIKE ALKKSNKGEL SGLLHQLQEK ERLLSAMKED
360 370 380 390 400
AAASKERCKR LTQEMMTEKE RSSVVIARMK DRIGTLEKEH NIFQNKMHAS
410 420 430 440 450
YQETQQMQMK FQQVQEQMEA EIAHLKQENG ILRDAVSNTT NQLESKQSAE
460 470 480 490 500
LNKLRQDCGR LVSELNEKTG KLQQEGVQKK NAEQAATQLK VQLQEAERRW
510 520 530 540 550
EEVQSYIRKR TAEHEAAQQD LQSKFVAKEN EVQSLHSKLT DTLVSKQQLE
560 570 580 590 600
QRLMQLMESE QKRASKEESL QIQVQDILEQ NEALKAQIQQ FHSQIAAQTS
610 620 630 640 650
ASVLAEELHK VIAEKDKQLK QTEDSLANEQ DHLASKEEEL KDVQNMNFLL
660 670 680 690 700
KAEVQKWQAL ANEQAATAHE VEKMQKSIHV KEDEIRLLEE QLQHEVASKM
710 720 730 740 750
EELKILSEQN KALQSEVRKL QTAVSQQPNK DVVEQMEKCI QEKDEKLRTV
760 770 780 790 800
EELLETGLIQ VATREEELSA IRTENSTLTR EVQELKAKQS DQVSFVSLIE
810 820 830 840 850
DLKRVIHEKD GQIKSVEELL EVELLKVANK EKTVQALKQE IEVLKEEIGN
860 870 880 890 900
AQLEKAHQLS VTSQVQELQN LLRGKEEQVN SMKAALEDRD RGLTGRGTCA
910 920 930 940 950
QVCSTPQFEE LESVLKEKDN EIKRIEVKLK DTESDVSKMS ELLKEVQEEN
960 970 980 990 1000
KFLKCQLSHQ KHQQASFPSQ EELQTVISEK EKEITDLCNE LESLKNAVEH
1010 1020 1030 1040 1050
QRKKNNDLRE KNWEAMEALA STEKMLQDRV NKTSKERRQH VEAIELESKD
1060 1070 1080 1090 1100
LLKRLFPTVS VPSNLNYSEW LRGFEKKAKA CVAGTSDAEA VKVLEHRLKE
1110 1120 1130 1140 1150
ASEMHTLLQL ECEKYKSVLA ETEGILQKLQ RSVEQEESKW KIKADESQRM
1160 1170 1180 1190 1200
IKQMQSSFTA SERELERLRQ ENKDMENLRR EREHLEMELE KAEMERSTYV
1210 1220 1230 1240 1250
MEVRELKDLL TELQKKLDDS YSEAVRQNEE LNLLKTQLNE THSKLQNEQT
1260 1270 1280 1290 1300
ERKKVADDLH KAQQSLNSIH SKISLKAAGD TVVIENSDIS PEMESPEKET
1310 1320
MSVSLNQTVT QLQQLLQEVN QQLTKET
Length:1,327
Mass (Da):152,592
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2B79EB332D2470E5
GO
Isoform 21 Publication (identifier: Q61595-2) [UniParc]FASTAAdd to basket
Also known as: KNT11 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     836-858: Missing.
     1007-1035: Missing.
     1154-1177: Missing.
     1208-1235: Missing.
     1294-1327: ESPEKETMSVSLNQTVTQLQQLLQEVNQQLTKET → SEVIGKLLVRS

Show »
Length:1,200
Mass (Da):137,685
Checksum:i9F21BBF1A1296AF5
GO
Isoform 31 Publication (identifier: Q61595-3) [UniParc]FASTAAdd to basket
Also known as: KNT21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     836-858: Missing.
     1007-1035: Missing.
     1154-1177: Missing.
     1294-1327: ESPEKETMSVSLNQTVTQLQQLLQEVNQQLTKET → SEVIGKLLVRS

Show »
Length:1,228
Mass (Da):140,972
Checksum:i09D6C89436C027B2
GO
Isoform 41 Publication (identifier: Q61595-4) [UniParc]FASTAAdd to basket
Also known as: KNT31 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     836-858: Missing.
     1007-1035: Missing.
     1208-1235: Missing.

Show »
Length:1,247
Mass (Da):143,299
Checksum:i8B3CDEC7CE1E27E4
GO
Isoform 51 Publication (identifier: Q61595-5) [UniParc]FASTAAdd to basket
Also known as: KNT41 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1007-1035: Missing.
     1294-1327: ESPEKETMSVSLNQTVTQLQQLLQEVNQQLTKET → SEVIGKLLVRS

Show »
Length:1,275
Mass (Da):146,485
Checksum:i190364AFD891180D
GO
Isoform 61 Publication (identifier: Q61595-6) [UniParc]FASTAAdd to basket
Also known as: KNT51 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1007-1035: Missing.
     1208-1235: Missing.
     1294-1327: ESPEKETMSVSLNQTVTQLQQLLQEVNQQLTKET → SEVIGKLLVRS

Show »
Length:1,247
Mass (Da):143,197
Checksum:i9123822187489987
GO
Isoform 71 Publication (identifier: Q61595-7) [UniParc]FASTAAdd to basket
Also known as: KNT61 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     836-858: Missing.
     1154-1177: Missing.

Show »
Length:1,280
Mass (Da):147,080
Checksum:i6D3882EAB538508A
GO
Isoform 81 Publication (identifier: Q61595-8) [UniParc]FASTAAdd to basket
Also known as: KNT71 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     836-858: Missing.
     1154-1177: Missing.
     1208-1235: Missing.

Show »
Length:1,252
Mass (Da):143,793
Checksum:iD29253A8BA93F690
GO
Isoform 91 Publication (identifier: Q61595-9) [UniParc]FASTAAdd to basket
Also known as: KNT81 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1154-1177: Missing.
     1208-1235: Missing.
     1294-1327: ESPEKETMSVSLNQTVTQLQQLLQEVNQQLTKET → SEVIGKLLVRS

Show »
Length:1,252
Mass (Da):143,691
Checksum:iE22B7B345595C1C4
GO
Isoform 101 Publication (identifier: Q61595-10) [UniParc]FASTAAdd to basket
Also known as: KNT91 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     836-858: Missing.
     1007-1035: Missing.

Show »
Length:1,275
Mass (Da):146,587
Checksum:i6565B2D957BB93B9
GO
Isoform 111 Publication (identifier: Q61595-11) [UniParc]FASTAAdd to basket
Also known as: KNT101 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     836-858: Missing.

Show »
Length:1,304
Mass (Da):149,991
Checksum:i74F773294C5BB1B8
GO
Isoform 121 Publication (identifier: Q61595-12) [UniParc]FASTAAdd to basket
Also known as: KNT111 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     836-858: Missing.
     1007-1035: Missing.
     1154-1177: Missing.
     1208-1235: Missing.

Show »
Length:1,223
Mass (Da):140,388
Checksum:i4C404E9FBE28B2CE
GO
Isoform 131 Publication (identifier: Q61595-13) [UniParc]FASTAAdd to basket
Also known as: KNT121 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     836-858: Missing.
     1208-1235: Missing.
     1294-1327: ESPEKETMSVSLNQTVTQLQQLLQEVNQQLTKET → SEVIGKLLVRS

Show »
Length:1,253
Mass (Da):144,001
Checksum:i7694ED9B53BE5DBE
GO
Isoform 141 Publication (identifier: Q61595-14) [UniParc]FASTAAdd to basket
Also known as: KNT131 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     836-858: Missing.
     1154-1177: Missing.
     1208-1235: Missing.
     1294-1327: ESPEKETMSVSLNQTVTQLQQLLQEVNQQLTKET → SEVIGKLLVRS

Show »
Length:1,229
Mass (Da):141,090
Checksum:i08BB311C8EFDC879
GO
Isoform 151 Publication (identifier: Q61595-15) [UniParc]FASTAAdd to basket
Also known as: KNT141 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1154-1177: Missing.
     1208-1235: Missing.

Show »
Length:1,275
Mass (Da):146,394
Checksum:iB886D7F71CE5B5BF
GO
Isoform 161 Publication (identifier: Q61595-16) [UniParc]FASTAAdd to basket
Also known as: KNT151 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     836-858: Missing.
     1007-1035: Missing.
     1208-1235: Missing.
     1294-1327: ESPEKETMSVSLNQTVTQLQQLLQEVNQQLTKET → SEVIGKLLVRS

Show »
Length:1,224
Mass (Da):140,596
Checksum:i092A3F8664BAE6FA
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 19 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WP85A0A087WP85_MOUSE
Kinectin
Ktn1
1,275Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WP14A0A087WP14_MOUSE
Kinectin
Ktn1
1,280Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WPX0A0A087WPX0_MOUSE
Kinectin
Ktn1
1,304Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WQQ5A0A087WQQ5_MOUSE
Kinectin
Ktn1
1,275Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VQC7F8VQC7_MOUSE
Kinectin
Ktn1
1,327Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WS29A0A087WS29_MOUSE
Kinectin
Ktn1
1,228Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WQF8A0A087WQF8_MOUSE
Kinectin
Ktn1
1,200Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WNW3A0A087WNW3_MOUSE
Kinectin
Ktn1
1,247Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WQ25A0A087WQ25_MOUSE
Kinectin
Ktn1
1,270Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WRS1A0A087WRS1_MOUSE
Kinectin
Ktn1
1,275Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti10I → V in BAC30538 (PubMed:16141072).Curated1
Sequence conflicti115Q → K in BAC30538 (PubMed:16141072).Curated1
Sequence conflicti178Missing (PubMed:16141072).Curated1
Sequence conflicti238M → I (PubMed:16141072).Curated1
Sequence conflicti360R → Q (PubMed:16141072).Curated1
Sequence conflicti1118V → VS in CAD56927 (PubMed:15316074).Curated1
Sequence conflicti1183E → G in CAD56935 (PubMed:15316074).Curated1
Sequence conflicti1238L → F in CAD56936 (PubMed:15316074).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_052042836 – 858Missing in isoform 2, isoform 3, isoform 4, isoform 7, isoform 8, isoform 10, isoform 11, isoform 12, isoform 13, isoform 14 and isoform 16. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_0520431007 – 1035Missing in isoform 2, isoform 3, isoform 4, isoform 5, isoform 6, isoform 10, isoform 12 and isoform 16. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_0520441154 – 1177Missing in isoform 2, isoform 3, isoform 7, isoform 8, isoform 9, isoform 12, isoform 14 and isoform 15. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_0520451208 – 1235Missing in isoform 2, isoform 4, isoform 6, isoform 8, isoform 9, isoform 12, isoform 13, isoform 14, isoform 15 and isoform 16. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_0520461294 – 1327ESPEK…LTKET → SEVIGKLLVRS in isoform 2, isoform 3, isoform 5, isoform 6, isoform 9, isoform 13, isoform 14 and isoform 16. 1 PublicationAdd BLAST34

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L43326 mRNA Translation: AAB65839.1
AK040200 mRNA Translation: BAC30538.1
AJ517365 mRNA Translation: CAD56924.1
AJ517366 mRNA Translation: CAD56925.1
AJ517367 mRNA Translation: CAD56926.1
AJ517368 mRNA Translation: CAD56927.1
AJ517369 mRNA Translation: CAD56928.1
AJ517370 mRNA Translation: CAD56929.1
AJ517371 mRNA Translation: CAD56930.1
AJ517372 mRNA Translation: CAD56931.1
AJ517373 mRNA Translation: CAD56932.1
AJ517374 mRNA Translation: CAD56933.1
AJ517375 mRNA Translation: CAD56934.1
AJ517376 mRNA Translation: CAD56935.1
AJ517377 mRNA Translation: CAD56936.1
AJ517378 mRNA Translation: CAD56937.1
AJ517379 mRNA Translation: CAD56938.1
AJ517380 mRNA Translation: CAD56939.1
AJ517381 mRNA Translation: CAD56940.1
AJ517382 mRNA Translation: CAD56941.1
AJ517383 mRNA Translation: CAD56942.1
AJ517384 mRNA Translation: CAD56943.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS36900.1 [Q61595-1]
CCDS84123.1 [Q61595-9]
CCDS84124.1 [Q61595-5]
CCDS84125.1 [Q61595-6]
CCDS84126.1 [Q61595-11]
CCDS84127.1 [Q61595-13]
CCDS84130.1 [Q61595-14]
CCDS84132.1 [Q61595-4]
CCDS84133.1 [Q61595-16]
CCDS84135.1 [Q61595-12]
CCDS84136.1 [Q61595-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001280564.1, NM_001293635.1
NP_001280565.1, NM_001293636.1
NP_001334448.1, NM_001347519.1
NP_001334449.1, NM_001347520.1
NP_001334450.1, NM_001347521.1
NP_001334452.1, NM_001347523.1
NP_001334453.1, NM_001347524.1
NP_001334454.1, NM_001347525.1
NP_001334455.1, NM_001347526.1
NP_001334456.1, NM_001347527.1
NP_001334457.1, NM_001347528.1
NP_032503.2, NM_008477.2

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
16709

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:16709

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L43326 mRNA Translation: AAB65839.1
AK040200 mRNA Translation: BAC30538.1
AJ517365 mRNA Translation: CAD56924.1
AJ517366 mRNA Translation: CAD56925.1
AJ517367 mRNA Translation: CAD56926.1
AJ517368 mRNA Translation: CAD56927.1
AJ517369 mRNA Translation: CAD56928.1
AJ517370 mRNA Translation: CAD56929.1
AJ517371 mRNA Translation: CAD56930.1
AJ517372 mRNA Translation: CAD56931.1
AJ517373 mRNA Translation: CAD56932.1
AJ517374 mRNA Translation: CAD56933.1
AJ517375 mRNA Translation: CAD56934.1
AJ517376 mRNA Translation: CAD56935.1
AJ517377 mRNA Translation: CAD56936.1
AJ517378 mRNA Translation: CAD56937.1
AJ517379 mRNA Translation: CAD56938.1
AJ517380 mRNA Translation: CAD56939.1
AJ517381 mRNA Translation: CAD56940.1
AJ517382 mRNA Translation: CAD56941.1
AJ517383 mRNA Translation: CAD56942.1
AJ517384 mRNA Translation: CAD56943.1
CCDSiCCDS36900.1 [Q61595-1]
CCDS84123.1 [Q61595-9]
CCDS84124.1 [Q61595-5]
CCDS84125.1 [Q61595-6]
CCDS84126.1 [Q61595-11]
CCDS84127.1 [Q61595-13]
CCDS84130.1 [Q61595-14]
CCDS84132.1 [Q61595-4]
CCDS84133.1 [Q61595-16]
CCDS84135.1 [Q61595-12]
CCDS84136.1 [Q61595-2]
RefSeqiNP_001280564.1, NM_001293635.1
NP_001280565.1, NM_001293636.1
NP_001334448.1, NM_001347519.1
NP_001334449.1, NM_001347520.1
NP_001334450.1, NM_001347521.1
NP_001334452.1, NM_001347523.1
NP_001334453.1, NM_001347524.1
NP_001334454.1, NM_001347525.1
NP_001334455.1, NM_001347526.1
NP_001334456.1, NM_001347527.1
NP_001334457.1, NM_001347528.1
NP_032503.2, NM_008477.2

3D structure databases

SMRiQ61595
ModBaseiSearch...

Protein-protein interaction databases

BioGridi201049, 80 interactors
IntActiQ61595, 8 interactors
MINTiQ61595
STRINGi10090.ENSMUSP00000140324

PTM databases

iPTMnetiQ61595
PhosphoSitePlusiQ61595
SwissPalmiQ61595

Proteomic databases

jPOSTiQ61595
PaxDbiQ61595
PeptideAtlasiQ61595
PRIDEiQ61595

Genome annotation databases

GeneIDi16709
KEGGimmu:16709

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
3895
MGIiMGI:109153 Ktn1

Phylogenomic databases

eggNOGiENOG410IIAW Eukaryota
ENOG410YAE3 LUCA
InParanoidiQ61595
KOiK17975
OrthoDBi327650at2759
PhylomeDBiQ61595

Enzyme and pathway databases

ReactomeiR-MMU-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
R-MMU-5625970 RHO GTPases activate KTN1
R-MMU-8957275 Post-translational protein phosphorylation

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Ktn1 mouse

Protein Ontology

More...
PROi
PR:Q61595

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Family and domain databases

InterProiView protein in InterPro
IPR024854 Kinectin
PANTHERiPTHR18864 PTHR18864, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKTN1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q61595
Secondary accession number(s): Q8BG49
, Q8BHF4, Q8BHM8, Q8C9Y5, Q8CG51, Q8CG52, Q8CG53, Q8CG54, Q8CG55, Q8CG56, Q8CG57, Q8CG58, Q8CG59, Q8CG60, Q8CG61, Q8CG62, Q8CG63
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2006
Last sequence update: November 1, 1996
Last modified: October 16, 2019
This is version 119 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again