Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q61481 (PDE1A_MOUSE)

Entry version 149 (02 Jun 2021)
Sequence version 3 (18 Sep 2019)
Previous versions | rss
Add a publicationFeedback
Protein

Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A

Gene

Pde1a

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. Has a higher affinity for cGMP than for cAMP.

1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

a divalent metal cationBy similarityNote: Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Type I PDE are activated by the binding of calmodulin in the presence of Ca2+.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei219Proton donorBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi223Divalent metal cation 1; via tele nitrogenBy similarity1
Metal bindingi259Divalent metal cation 1; via tele nitrogenBy similarity1
Metal bindingi260Divalent metal cation 1By similarity1
Metal bindingi260Divalent metal cation 2By similarity1
Metal bindingi366Divalent metal cation 1By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalmodulin-binding, Hydrolase
LigandcAMP, cGMP, Metal-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		3.1.4.17, 3474

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-111957, Cam-PDE 1 activation
R-MMU-418457, cGMP effects
R-MMU-418555, G alpha (s) signalling events

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A (EC:3.1.4.171 Publication)
Short name:
Cam-PDE 1A
Alternative name(s):
61 kDa Cam-PDE
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Pde1a
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:1201792, Pde1a

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001987861 – 545Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1AAdd BLAST545

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q61481

PeptideAtlas

More...PeptideAtlasi		Q61481

PRoteomics IDEntifications database

More...PRIDEi		Q61481

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		294038 [Q61481-4]
294039 [Q61481-2]
337264
340829
344638

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q61481

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q61481

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain, kidney and testis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000059173, Expressed in spermatid and 247 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q61481, baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

Interacts with YWHAZ.

By similarity

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		202074, 7 interactors

Protein interaction database and analysis system

More...IntActi		Q61481, 4 interactors

Molecular INTeraction database

More...MINTi		Q61481

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000099711

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q61481, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q61481

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini142 – 522PDEasePROSITE-ProRule annotationAdd BLAST381

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni24 – 44Calmodulin-bindingAdd BLAST21
Regioni526 – 545DisorderedSequence analysisAdd BLAST20

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the cyclic nucleotide phosphodiesterase family. PDE1 subfamily.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3688, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000157043

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_005940_1_5_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q61481

Database of Orthologous Groups

More...OrthoDBi		904682at2759

TreeFam database of animal gene trees

More...TreeFami		TF314638

Family and domain databases

Conserved Domains Database

More...CDDi		cd00077, HDc, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.1300.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR003607, HD/PDEase_dom
IPR023088, PDEase
IPR002073, PDEase_catalytic_dom
IPR036971, PDEase_catalytic_dom_sf
IPR023174, PDEase_CS
IPR013706, PDEase_N

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00233, PDEase_I, 1 hit
PF08499, PDEase_I_N, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00387, PDIESTERASE1

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00471, HDc, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00126, PDEASE_I_1, 1 hit
PS51845, PDEASE_I_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q61481-4) [UniParc]FASTAAdd to basket
Also known as: Pde1a_v21 Publication, mmPDE1A21 Publication

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGSTDTDIEE LENATYKYLI GEQTEKMWQR LKGILRCLVK QLEKGDVNVV 
        60         70         80         90        100
DLKKNIEYAA SVLEAVYIDE TRRLLDTEDE LSDIQTDSVP SEVRDWLAST 
       110        120        130        140        150
FTRKMGMMKK KPEEKPKFRS IVHAVQAGIF VERMYRKNYH MVGLTYPAAV 
       160        170        180        190        200
IVTLKEVDKW SFDVFALNEA SGEHSLKFMI YELFTRYDLI NRFKIPVSCL 
       210        220        230        240        250
IAFAEALEVG YSKHKNPYHN LVHAADVTQT VHYIMLHTGI MHWLTELEIL 
       260        270        280        290        300
AMVFAAAIHD YEHTGTTNNF HIQTRSDVAI LYNDRSVLEN HHVSAAYRLM 
       310        320        330        340        350
QEEEMNILVN LSKDDWRDLR NLVIEMVLAT DMSGHFQQIK NIRNSLQQPE 
       360        370        380        390        400
GIDRAKTMSL ILHAADISHP AKTWKLHYRW TMALMEEFFL QGDKEAELGL 
       410        420        430        440        450
PFSPLCDRKS TMVAQSQIGF IDFIVEPTFS LLTDSTEKIV IPLIEEASKS 
       460        470        480        490        500
QSSNYGASSS STMIGFHVAD SLRRSNTKGS VCDGSYAPDY SLSAVDLKSF 
       510        520        530        540 
KNNLVDIIQQ NKERWKELAA QGELDLHKNS EELGNTEEKH ADTRP
Length:545
Mass (Da):62,347
Last modified:September 18, 2019 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5B794C8DE8456917
GO
Isoform 2 (identifier: Q61481-5) [UniParc]FASTAAdd to basket
Also known as: Pde1a_v71 Publication, mmPDE1A71 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: MGSTDTDIEELENATYKYLIGEQTEKMWQRLKGILRCLVKQLEKGDVNVVDLKKNIEYAASVLEAVYIDET → MIF
     523-524: EL → CC
     525-545: Missing.

Show »
Length:456
Mass (Da):52,164
Checksum:iEE16EE1FD6837104
GO
Isoform 3 (identifier: Q61481-6) [UniParc]FASTAAdd to basket
Also known as: Pde1a_v91 Publication, mmPDE1A91 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: MGSTDTDIEELENATYKYLIGEQTEKMWQRLKGILRCLVKQLEKGDVNVVDLKKNIEYAASVLEAVYIDET → MIF
     522-533: GELDLHKNSEEL → EPKSILQEQRCC
     534-545: Missing.

Show »
Length:465
Mass (Da):53,316
Checksum:iF5F5A5A1633CADB0
GO
Isoform 4 (identifier: Q61481-2) [UniParc]FASTAAdd to basket
Also known as: PDE1A1, Pde1a_v11 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MGSTDTDIEELENATYKYLIGEQTEKMWQRLKGI → MDEYVTIRKKHLQRPIFR

Show »
Length:529
Mass (Da):60,685
Checksum:iF7C02D4DF7B290E6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A2ASF9A2ASF9_MOUSE
Phosphodiesterase
Pde1a
420Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6X0V1F6X0V1_MOUSE
Phosphodiesterase
Pde1a
476Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB03319 differs from that shown. Probable cloning artifact.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0603111 – 71MGSTD…YIDET → MIF in isoform 2 and isoform 3. 1 PublicationAdd BLAST71
Alternative sequenceiVSP_0045511 – 34MGSTD…RLKGI → MDEYVTIRKKHLQRPIFR in isoform 4. CuratedAdd BLAST34
Alternative sequenceiVSP_060312522 – 533GELDL…NSEEL → EPKSILQEQRCC in isoform 3. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_060313523 – 524EL → CC in isoform 2. 1 Publication2
Alternative sequenceiVSP_060314525 – 545Missing in isoform 2. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_060315534 – 545Missing in isoform 3. 1 PublicationAdd BLAST12

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF159298 mRNA Translation: AAF63857.1
AY845864 mRNA Translation: AAW31879.1
U56649 mRNA Translation: AAB03319.1 Sequence problems.
AK043647 mRNA Translation: BAC31606.1
AL844577 Genomic DNA No translation available.
AL928607 Genomic DNA No translation available.
AL928811 Genomic DNA No translation available.
CH466519 Genomic DNA Translation: EDL27255.1
CH466519 Genomic DNA Translation: EDL27256.1
CH466519 Genomic DNA Translation: EDL27257.1
BC090628 mRNA Translation: AAH90628.1
AF023529 mRNA Translation: AAB81952.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS16172.1 [Q61481-4]
CCDS16173.1 [Q61481-5]
CCDS16174.1 [Q61481-6]

NCBI Reference Sequences

More...RefSeqi		NP_001009978.1, NM_001009978.1 [Q61481-5]
NP_001009979.1, NM_001009979.1 [Q61481-6]
NP_001153054.1, NM_001159582.1 [Q61481-4]
NP_058024.2, NM_016744.4 [Q61481-4]
XP_006498982.1, XM_006498919.3 [Q61481-4]
XP_006498983.1, XM_006498920.3
XP_006498984.1, XM_006498921.3
XP_006498986.1, XM_006498923.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000102651; ENSMUSP00000099711; ENSMUSG00000059173 [Q61481-6]
ENSMUST00000102652; ENSMUSP00000099712; ENSMUSG00000059173 [Q61481-5]
ENSMUST00000102653; ENSMUSP00000099713; ENSMUSG00000059173 [Q61481-4]
ENSMUST00000102654; ENSMUSP00000099714; ENSMUSG00000059173 [Q61481-4]
ENSMUST00000102655; ENSMUSP00000099715; ENSMUSG00000059173 [Q61481-4]
ENSMUST00000183775; ENSMUSP00000139327; ENSMUSG00000059173 [Q61481-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		18573

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:18573

UCSC genome browser

More...UCSCi		uc008khd.2, mouse [Q61481-4]
uc008khe.1, mouse
uc008khf.1, mouse

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF159298 mRNA Translation: AAF63857.1
AY845864 mRNA Translation: AAW31879.1
U56649 mRNA Translation: AAB03319.1 Sequence problems.
AK043647 mRNA Translation: BAC31606.1
AL844577 Genomic DNA No translation available.
AL928607 Genomic DNA No translation available.
AL928811 Genomic DNA No translation available.
CH466519 Genomic DNA Translation: EDL27255.1
CH466519 Genomic DNA Translation: EDL27256.1
CH466519 Genomic DNA Translation: EDL27257.1
BC090628 mRNA Translation: AAH90628.1
AF023529 mRNA Translation: AAB81952.1
CCDSiCCDS16172.1 [Q61481-4]
CCDS16173.1 [Q61481-5]
CCDS16174.1 [Q61481-6]
RefSeqiNP_001009978.1, NM_001009978.1 [Q61481-5]
NP_001009979.1, NM_001009979.1 [Q61481-6]
NP_001153054.1, NM_001159582.1 [Q61481-4]
NP_058024.2, NM_016744.4 [Q61481-4]
XP_006498982.1, XM_006498919.3 [Q61481-4]
XP_006498983.1, XM_006498920.3
XP_006498984.1, XM_006498921.3
XP_006498986.1, XM_006498923.3

3D structure databases

SMRiQ61481
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi202074, 7 interactors
IntActiQ61481, 4 interactors
MINTiQ61481
STRINGi10090.ENSMUSP00000099711

PTM databases

iPTMnetiQ61481
PhosphoSitePlusiQ61481

Proteomic databases

PaxDbiQ61481
PeptideAtlasiQ61481
PRIDEiQ61481
ProteomicsDBi294038 [Q61481-4]
294039 [Q61481-2]
337264
340829
344638

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		19750, 259 antibodies

The DNASU plasmid repository

More...DNASUi		18573

Genome annotation databases

EnsembliENSMUST00000102651; ENSMUSP00000099711; ENSMUSG00000059173 [Q61481-6]
ENSMUST00000102652; ENSMUSP00000099712; ENSMUSG00000059173 [Q61481-5]
ENSMUST00000102653; ENSMUSP00000099713; ENSMUSG00000059173 [Q61481-4]
ENSMUST00000102654; ENSMUSP00000099714; ENSMUSG00000059173 [Q61481-4]
ENSMUST00000102655; ENSMUSP00000099715; ENSMUSG00000059173 [Q61481-4]
ENSMUST00000183775; ENSMUSP00000139327; ENSMUSG00000059173 [Q61481-4]
GeneIDi18573
KEGGimmu:18573
UCSCiuc008khd.2, mouse [Q61481-4]
uc008khe.1, mouse
uc008khf.1, mouse

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		5136
MGIiMGI:1201792, Pde1a

Phylogenomic databases

eggNOGiKOG3688, Eukaryota
GeneTreeiENSGT00940000157043
HOGENOMiCLU_005940_1_5_1
InParanoidiQ61481
OrthoDBi904682at2759
TreeFamiTF314638

Enzyme and pathway databases

BRENDAi3.1.4.17, 3474
ReactomeiR-MMU-111957, Cam-PDE 1 activation
R-MMU-418457, cGMP effects
R-MMU-418555, G alpha (s) signalling events

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		18573, 3 hits in 52 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Pde1a, mouse

Protein Ontology

More...PROi		PR:Q61481
RNActiQ61481, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000059173, Expressed in spermatid and 247 other tissues
ExpressionAtlasiQ61481, baseline and differential

Family and domain databases

CDDicd00077, HDc, 1 hit
Gene3Di1.10.1300.10, 1 hit
InterProiView protein in InterPro
IPR003607, HD/PDEase_dom
IPR023088, PDEase
IPR002073, PDEase_catalytic_dom
IPR036971, PDEase_catalytic_dom_sf
IPR023174, PDEase_CS
IPR013706, PDEase_N
PfamiView protein in Pfam
PF00233, PDEase_I, 1 hit
PF08499, PDEase_I_N, 1 hit
PRINTSiPR00387, PDIESTERASE1
SMARTiView protein in SMART
SM00471, HDc, 1 hit
PROSITEiView protein in PROSITE
PS00126, PDEASE_I_1, 1 hit
PS51845, PDEASE_I_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPDE1A_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q61481
Secondary accession number(s): E9Q6V1
, O35388, Q5I7S8, Q8BRR9, Q9JLL9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: September 18, 2019
Last modified: June 2, 2021
This is version 149 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again