Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 142 (16 Oct 2019)
Sequence version 3 (22 Nov 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Eukaryotic translation initiation factor 2D

Gene

Eif2d

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Translation initiation factor that is able to deliver tRNA to the P-site of the eukaryotic ribosome in a GTP-independent manner. The binding of Met-tRNA(I) occurs after the AUG codon finds its position in the P-site of 40S ribosomes, the situation that takes place during initiation complex formation on some specific RNAs. Its activity in tRNA binding with 40S subunits does not require the presence of the aminoacyl moiety. Possesses the unique ability to deliver non-Met (elongator) tRNAs into the P-site of the 40S subunit. In addition to its role in initiation, can promote release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionInitiation factor
Biological processProtein biosynthesis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Eukaryotic translation initiation factor 2D
Short name:
eIF2D
Alternative name(s):
Ligatin
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Eif2d
Synonyms:Lgtn
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:109342 Eif2d

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001306121 – 570Eukaryotic translation initiation factor 2DAdd BLAST570

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineBy similarity1
Modified residuei238PhosphoserineCombined sources1
Modified residuei241PhosphoserineCombined sources1
Modified residuei348PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q61211

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q61211

PRoteomics IDEntifications database

More...
PRIDEi
Q61211

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q61211

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q61211

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q61211

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
Q61211

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000026427 Expressed in 290 organ(s), highest expression level in embryo

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q61211 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q61211 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
201151, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000063894

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q61211

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini93 – 173PUAPROSITE-ProRule annotationAdd BLAST81
Domaini478 – 548SUI1PROSITE-ProRule annotationAdd BLAST71

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the eIF2D family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2522 Eukaryota
ENOG410XSAV LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00550000074865

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q61211

KEGG Orthology (KO)

More...
KOi
K15027

Database of Orthologous Groups

More...
OrthoDBi
401807at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q61211

TreeFam database of animal gene trees

More...
TreeFami
TF105830

Family and domain databases

Conserved Domains Database

More...
CDDi
cd11608 eIF2D_C, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.130.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR039757 EIF2D
IPR039759 eIF2D_SUI1
IPR041366 Pre-PUA
IPR002478 PUA
IPR015947 PUA-like_sf
IPR036974 PUA_sf
IPR001950 SUI1
IPR036877 SUI1_dom_sf
IPR036885 SWIB_MDM2_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR12217 PTHR12217, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF17832 Pre-PUA, 1 hit
PF01253 SUI1, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00359 PUA, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47592 SSF47592, 1 hit
SSF55159 SSF55159, 1 hit
SSF88697 SSF88697, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50890 PUA, 1 hit
PS50296 SUI1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q61211-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFAKAFRVKS NTAIKGSDRR KLRADVTAAF PALGTDQISE LIPGKEELNV
60 70 80 90 100
VKLYVHKGDS VTVYTSGGNP ILFELEKNLY PTVYTLWAYP DILPTFITWP
110 120 130 140 150
LVLEKLVGGA DLMLPGVVVP PTGLPQVQQG DLCAIALVGN RAPVAIGVAA
160 170 180 190 200
MSTAQMLASG LKGKGVSVLH TYQDHLWRSG DKSSPPAIAP LDPTDSCEEK
210 220 230 240 250
VHLGLQGNLK SLTLDGEEEN GQVPLREASE DTSSRAPSQD SLDGKPLQEQ
260 270 280 290 300
MDDLLLRCFL HALKSRVKKA DLPLLTSTLL GSHMFSCCPE GQQLDIKKSS
310 320 330 340 350
YKKLSKFLQH MQQEQIVQVK ELSKGVESIV AVDWRHPRIT SFVIPEPSLT
360 370 380 390 400
SQTVQEVSRE QPYLPPDIKS LYCVPANMTQ LFLESGHKKG STLEGSEVRK
410 420 430 440 450
IITDYAKRNR LVDADNRNLV KLDPILCDCI LEKNEQHLVT KLPWDCLLTR
460 470 480 490 500
CLKNMQPAYQ VTFPGQEPIL KKGKLCPIDI TLALKTYNKK VTVVRNLETY
510 520 530 540 550
GLDPCSVAAI LQQRCQASTI VSPAPGAKDS LQVQVQGNQI HHLGQLLLEE
560 570
YRLPGKYIQG LEKAPKPGKK
Length:570
Mass (Da):62,830
Last modified:November 22, 2005 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i68DAA2768A595AC8
GO
Isoform 2 (identifier: Q61211-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     551-570: YRLPGKYIQGLEKAPKPGKK → NTGTLHLPAQYPHPHVQNKPEIPHLSCCGLPASHDSI

Note: No experimental confirmation available.
Show »
Length:587
Mass (Da):64,569
Checksum:iB7728E545EA0E496
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q8C8I3Q8C8I3_MOUSE
Eukaryotic translation initiation f...
Eif2d Lgtn
453Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PUG7E9PUG7_MOUSE
Eukaryotic translation initiation f...
Eif2d
552Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0R4J298A0A0R4J298_MOUSE
Eukaryotic translation initiation f...
Eif2d
587Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QWK9M0QWK9_MOUSE
Eukaryotic translation initiation f...
Eif2d
176Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAC53056 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti176 – 179LWRS → HASA in AAH24501 (PubMed:15489334).Curated4
Sequence conflicti177W → V in AAC53056 (PubMed:9070942).Curated1
Sequence conflicti249E → K in BAE36281 (PubMed:16141072).Curated1
Sequence conflicti268K → E in BAE41662 (PubMed:16141072).Curated1
Sequence conflicti289P → R in BAE40091 (PubMed:16141072).Curated1
Sequence conflicti341S → P in BAC28591 (PubMed:16141072).Curated1
Sequence conflicti549E → G in BAC29323 (PubMed:16141072).Curated1
Sequence conflicti549E → G in BAC38598 (PubMed:16141072).Curated1
Sequence conflicti549E → G (PubMed:9070942).Curated1
Sequence conflicti550 – 552EYR → IMW in BAC28591 (PubMed:16141072).Curated3

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_016233551 – 570YRLPG…KPGKK → NTGTLHLPAQYPHPHVQNKP EIPHLSCCGLPASHDSI in isoform 2. 1 PublicationAdd BLAST20

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK034115 mRNA Translation: BAC28591.1
AK036154 mRNA Translation: BAC29323.1
AK046539 mRNA Translation: BAC32777.1
AK082748 mRNA Translation: BAC38598.1
AK083638 mRNA Translation: BAC38976.1
AK139052 mRNA Translation: BAE23874.1
AK161269 mRNA Translation: BAE36281.1
AK167980 mRNA Translation: BAE39972.1
AK168120 mRNA Translation: BAE40091.1
AK170252 mRNA Translation: BAE41662.1
AK170448 mRNA Translation: BAE41806.1
AK171115 mRNA Translation: BAE42257.1
BC024501 mRNA Translation: AAH24501.1
BC025036 mRNA Translation: AAH25036.1
U58337 mRNA Translation: AAC53056.1 Frameshift.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS48354.1 [Q61211-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001129542.1, NM_001136070.1 [Q61211-1]
NP_034839.2, NM_010709.3
XP_006529228.1, XM_006529165.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000068805; ENSMUSP00000063894; ENSMUSG00000026427 [Q61211-1]
ENSMUST00000151874; ENSMUSP00000138061; ENSMUSG00000026427 [Q61211-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
16865

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:16865

UCSC genome browser

More...
UCSCi
uc007cmz.2 mouse [Q61211-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK034115 mRNA Translation: BAC28591.1
AK036154 mRNA Translation: BAC29323.1
AK046539 mRNA Translation: BAC32777.1
AK082748 mRNA Translation: BAC38598.1
AK083638 mRNA Translation: BAC38976.1
AK139052 mRNA Translation: BAE23874.1
AK161269 mRNA Translation: BAE36281.1
AK167980 mRNA Translation: BAE39972.1
AK168120 mRNA Translation: BAE40091.1
AK170252 mRNA Translation: BAE41662.1
AK170448 mRNA Translation: BAE41806.1
AK171115 mRNA Translation: BAE42257.1
BC024501 mRNA Translation: AAH24501.1
BC025036 mRNA Translation: AAH25036.1
U58337 mRNA Translation: AAC53056.1 Frameshift.
CCDSiCCDS48354.1 [Q61211-1]
RefSeqiNP_001129542.1, NM_001136070.1 [Q61211-1]
NP_034839.2, NM_010709.3
XP_006529228.1, XM_006529165.3

3D structure databases

SMRiQ61211
ModBaseiSearch...

Protein-protein interaction databases

BioGridi201151, 1 interactor
STRINGi10090.ENSMUSP00000063894

PTM databases

iPTMnetiQ61211
PhosphoSitePlusiQ61211
SwissPalmiQ61211

Proteomic databases

EPDiQ61211
PaxDbiQ61211
PRIDEiQ61211

Genome annotation databases

EnsembliENSMUST00000068805; ENSMUSP00000063894; ENSMUSG00000026427 [Q61211-1]
ENSMUST00000151874; ENSMUSP00000138061; ENSMUSG00000026427 [Q61211-1]
GeneIDi16865
KEGGimmu:16865
UCSCiuc007cmz.2 mouse [Q61211-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1939
MGIiMGI:109342 Eif2d

Phylogenomic databases

eggNOGiKOG2522 Eukaryota
ENOG410XSAV LUCA
GeneTreeiENSGT00550000074865
InParanoidiQ61211
KOiK15027
OrthoDBi401807at2759
PhylomeDBiQ61211
TreeFamiTF105830

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Eif2d mouse
PMAP-CutDBiQ61211

Protein Ontology

More...
PROi
PR:Q61211

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000026427 Expressed in 290 organ(s), highest expression level in embryo
ExpressionAtlasiQ61211 baseline and differential
GenevisibleiQ61211 MM

Family and domain databases

CDDicd11608 eIF2D_C, 1 hit
Gene3Di2.30.130.10, 1 hit
InterProiView protein in InterPro
IPR039757 EIF2D
IPR039759 eIF2D_SUI1
IPR041366 Pre-PUA
IPR002478 PUA
IPR015947 PUA-like_sf
IPR036974 PUA_sf
IPR001950 SUI1
IPR036877 SUI1_dom_sf
IPR036885 SWIB_MDM2_dom_sf
PANTHERiPTHR12217 PTHR12217, 1 hit
PfamiView protein in Pfam
PF17832 Pre-PUA, 1 hit
PF01253 SUI1, 1 hit
SMARTiView protein in SMART
SM00359 PUA, 1 hit
SUPFAMiSSF47592 SSF47592, 1 hit
SSF55159 SSF55159, 1 hit
SSF88697 SSF88697, 1 hit
PROSITEiView protein in PROSITE
PS50890 PUA, 1 hit
PS50296 SUI1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiEIF2D_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q61211
Secondary accession number(s): Q3TDE0
, Q3THV5, Q3TTP4, Q8C491, Q8CBF1, Q8CC17, Q8R1I9, Q8R3M5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 22, 2005
Last modified: October 16, 2019
This is version 142 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again