Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 159 (12 Aug 2020)
Sequence version 2 (29 Aug 2003)
Previous versions | rss
Add a publicationFeedback
Protein

Rho guanine nucleotide exchange factor 1

Gene

Arhgef1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Seems to play a role in the regulation of RhoA GTPase by guanine nucleotide-binding alpha-12 (GNA12) and alpha-13 (GNA13) subunits. Acts as GTPase-activating protein (GAP) for GNA12 and GNA13, and as guanine nucleotide exchange factor (GEF) for RhoA GTPase. Activated G alpha 13/GNA13 stimulates the RhoGEF activity through interaction with the RGS-like domain. This GEF activity is inhibited by binding to activated GNA12. Mediates angiotensin-2-induced RhoA activation. Isoform 3 and isoform 4 do not homooligomerize and show an enhanced RhoGEF activity.2 Publications

Caution

Ref. 2 sequence was originally submitted as from rat origin.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGTPase activation, Guanine-nucleotide releasing factor

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-193648, NRAGE signals death through JNK
R-MMU-194840, Rho GTPase cycle
R-MMU-416482, G alpha (12/13) signalling events

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Rho guanine nucleotide exchange factor 1
Alternative name(s):
Lbc's second cousin
Lymphoid blast crisis-like 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Arhgef1
Synonyms:Lbcl2, Lsc
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1353510, Arhgef1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mice have reduced response to angiotensin-2 and lowered RhoA signaling pathway.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000809071 – 920Rho guanine nucleotide exchange factor 1Add BLAST920

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei373PhosphoserineBy similarity1
Modified residuei408PhosphoserineBy similarity1
Modified residuei694PhosphothreonineBy similarity1
Modified residuei737Phosphotyrosine; by JAK21 Publication1
Modified residuei905PhosphoserineCombined sources1
Isoform 5 (identifier: Q61210-5)
Modified residuei386PhosphoserineCombined sources1
Modified residuei390PhosphoserineCombined sources1
Modified residuei412PhosphoserineCombined sources1
Modified residuei432PhosphothreonineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by PKCA (By similarity). Angiotensin-2 induced Tyr-737 phosphorylation is mediated by JAK2. Isoform 5 is phosphorylated at 'Ser-390'.By similarity1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q61210

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q61210

PeptideAtlas

More...
PeptideAtlasi
Q61210

PRoteomics IDEntifications database

More...
PRIDEi
Q61210

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q61210

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q61210

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q61210

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000040940, Expressed in granulocyte and 289 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q61210, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with RHOA, GNA12 and GNA13 (By similarity). Homooligomerizes through the coiled coil region.

Interacts with CTNNAL1 (By similarity). May interact with CCPG1.

By similarity2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
201115, 6 interactors

Protein interaction database and analysis system

More...
IntActi
Q61210, 12 interactors

Molecular INTeraction database

More...
MINTi
Q61210

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000096280

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q61210, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q61210

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini39 – 230RGSLAdd BLAST192
Domaini415 – 604DHPROSITE-ProRule annotationAdd BLAST190
Domaini646 – 759PHPROSITE-ProRule annotationAdd BLAST114

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili865 – 894Sequence analysisAdd BLAST30

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The RGSL domain, also known as rgRGS domain, is necessary but not sufficient for full GAP activity.By similarity
The DH domain is involved in interaction with CCPG1.

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3520, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161180

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_003962_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q61210

KEGG Orthology (KO)

More...
KOi
K12330

Identification of Orthologs from Complete Genome Data

More...
OMAi
PAHLMAF

Database of Orthologous Groups

More...
OrthoDBi
319635at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q61210

TreeFam database of animal gene trees

More...
TreeFami
TF106495

Family and domain databases

Conserved Domains Database

More...
CDDi
cd08755, RGS_p115RhoGEF, 1 hit
cd00160, RhoGEF, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.900.10, 1 hit
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR035899, DBL_dom_sf
IPR000219, DH-domain
IPR037887, p115RhoGEF_RGS
IPR011993, PH-like_dom_sf
IPR041020, PH_16
IPR001849, PH_domain
IPR015212, RGS-like_dom
IPR036305, RGS_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF17838, PH_16, 1 hit
PF09128, RGS-like, 1 hit
PF00621, RhoGEF, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00233, PH, 1 hit
SM00325, RhoGEF, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48065, SSF48065, 1 hit
SSF48097, SSF48097, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50010, DH_2, 1 hit
PS50003, PH_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q61210-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGEVAGGAAP GPPRSGLVSI IIGAEDEDFE NELEANSEDQ NSQFQSLEQV
60 70 80 90 100
KRRPAHLMAL LQHVALQFEP GPLLCCLHAD MLSSLGPKEA KKAFLDFYHS
110 120 130 140 150
FLEKTAVLRV PVPPSVAFEL DRTRPDLISE DVQRRFIQEV VQSQQAAVSR
160 170 180 190 200
QLEDFRSKRL MGMTPWEQEL SLLEPWIGKD RGNYEARERH VAERLLSHLE
210 220 230 240 250
ETQHTISTDE EKSAAVVTAI SLYMRHLGVR TKSGDKKSGR NFFRKKVMGN
260 270 280 290 300
RRSDEPPKTK KGLSSILDPA RWNRGEPSAP DCRHLKVEAD AEKPGPADRK
310 320 330 340 350
GGLGMSSRDR TVGTPGQDNP GVSLHPLSTD SVDSREPGVD TPQEPGDTPP
360 370 380 390 400
QGPTSLEPLA PPESTEDNGE TESPEPGDDG EPGRSGLELE PEEPPGWREL
410 420 430 440 450
VPPDTLLSLP KSQVKRQEVI SELLVTEAAH VRMLRVLHDL FYQPMADGGF
460 470 480 490 500
FPLDELQNIF PSLDELIEVH SLFLDRLMKR RQESGYLIEE IGDVLLARFD
510 520 530 540 550
GAEGSWFQKI SSRFCSRQSF ALEQLKAKQR KEPRFCAFVQ EAESRPRCRR
560 570 580 590 600
LQLKDMIPTE MQRLTKYPLL LQSIGQNTEE STERGKVELA AECCREILHH
610 620 630 640 650
VNQAVRDMED LLRLKDYQRR LDLTHLRQSS DPMLSEFKNL DITKKKLVHE
660 670 680 690 700
GPLTWRVTKD KAIEVHVLLL DDLLLLLQRQ DERLLLKSHS RTLTPTPDGK
710 720 730 740 750
TMLRPVLRLT SAMTREVATD HKAFYVIFTW DQEAQIYELV AQTSSERKNW
760 770 780 790 800
CNLITETAGS LKVPAPASRL KPRPSPSSIR EPLLSSSENG TGGAEMAPAD
810 820 830 840 850
ARTERLLNDL LPFCRPGPEG QLAATALQKV LSLKQILLST EEDSGAGPPR
860 870 880 890 900
DGDGVPGGRA PGPVHTQEIE ENLLSLEVAI RQLEELEEEF CRLRPLLSQL
910 920
GGTLSPNLAA PERSAQTGLS
Length:920
Mass (Da):102,805
Last modified:August 29, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i913A819972CBACC8
GO
Isoform 2 (identifier: Q61210-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     291-291: Missing.

Show »
Length:919
Mass (Da):102,733
Checksum:i751EBF35E31F38BB
GO
Isoform 3 (identifier: Q61210-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     780-791: REPLLSSSENGT → SHPRGLEQREIG
     792-920: Missing.

Show »
Length:791
Mass (Da):89,294
Checksum:i07126CD40D75A2C1
GO
Isoform 4 (identifier: Q61210-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     830-856: VLSLKQILLSTEEDSGAGPPRDGDGVP → GVGRGILSPKTPPVPAWGDSVPQPGCT
     857-920: Missing.

Show »
Length:856
Mass (Da):95,823
Checksum:i99B42F760C3435C6
GO
Isoform 5 (identifier: Q61210-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     291-291: Missing.
     372-373: ES → ERRWKRLSGRLGRSESLRVSDRRRPSRGSLGAKGRGGGRSRSDVDMDPGSATAVLGPTRRAT

Show »
Length:979
Mass (Da):109,249
Checksum:iFEF62EF944FFABD6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PUF7E9PUF7_MOUSE
Rho guanine nucleotide exchange fac...
Arhgef1
976Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6ZN61F6ZN61_MOUSE
Rho guanine nucleotide exchange fac...
Arhgef1
616Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RPN7A0A0U1RPN7_MOUSE
Rho guanine nucleotide exchange fac...
Arhgef1
233Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3YVJ9D3YVJ9_MOUSE
Rho guanine nucleotide exchange fac...
Arhgef1
101Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RPH2A0A0U1RPH2_MOUSE
Rho guanine nucleotide exchange fac...
Arhgef1
102Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RPP2A0A0U1RPP2_MOUSE
Rho guanine nucleotide exchange fac...
Arhgef1
192Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RNQ2A0A0U1RNQ2_MOUSE
Rho guanine nucleotide exchange fac...
Arhgef1
30Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti574I → M in AAC36527 (PubMed:9798653).Curated1
Sequence conflicti663I → T in AAC36527 (PubMed:9798653).Curated1
Sequence conflicti689H → Y in AAO91659 (PubMed:12773540).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_008126291Missing in isoform 2 and isoform 5. 3 Publications1
Alternative sequenceiVSP_026131372 – 373ES → ERRWKRLSGRLGRSESLRVS DRRRPSRGSLGAKGRGGGRS RSDVDMDPGSATAVLGPTRR AT in isoform 5. 1 Publication2
Alternative sequenceiVSP_008127780 – 791REPLL…SENGT → SHPRGLEQREIG in isoform 3. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_008128792 – 920Missing in isoform 3. 1 PublicationAdd BLAST129
Alternative sequenceiVSP_008129830 – 856VLSLK…GDGVP → GVGRGILSPKTPPVPAWGDS VPQPGCT in isoform 4. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_008130857 – 920Missing in isoform 4. 1 PublicationAdd BLAST64

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U58203 mRNA Translation: AAC52693.1
AF314539 mRNA Translation: AAG33860.1
AK157056 mRNA Translation: BAE33947.1
AK172354 mRNA Translation: BAE42963.1
BC012488 mRNA Translation: AAH12488.1
U89421 mRNA Translation: AAC36527.1
AY246272 mRNA Translation: AAO91658.1
AY246273 mRNA Translation: AAO91659.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS52141.1 [Q61210-1]
CCDS52142.1 [Q61210-5]
CCDS85239.1 [Q61210-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001123622.1, NM_001130150.1 [Q61210-5]
NP_001123623.1, NM_001130151.1
NP_001123624.1, NM_001130152.1 [Q61210-1]
NP_001123625.1, NM_001130153.1 [Q61210-1]
NP_032514.1, NM_008488.2 [Q61210-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000047873; ENSMUSP00000046469; ENSMUSG00000040940 [Q61210-1]
ENSMUST00000098683; ENSMUSP00000096280; ENSMUSG00000040940 [Q61210-5]
ENSMUST00000117419; ENSMUSP00000113366; ENSMUSG00000040940 [Q61210-1]
ENSMUST00000206508; ENSMUSP00000146314; ENSMUSG00000040940 [Q61210-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
16801

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:16801

UCSC genome browser

More...
UCSCi
uc009fqv.2, mouse [Q61210-2]
uc009fqw.2, mouse [Q61210-5]
uc009fqy.2, mouse [Q61210-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U58203 mRNA Translation: AAC52693.1
AF314539 mRNA Translation: AAG33860.1
AK157056 mRNA Translation: BAE33947.1
AK172354 mRNA Translation: BAE42963.1
BC012488 mRNA Translation: AAH12488.1
U89421 mRNA Translation: AAC36527.1
AY246272 mRNA Translation: AAO91658.1
AY246273 mRNA Translation: AAO91659.1
CCDSiCCDS52141.1 [Q61210-1]
CCDS52142.1 [Q61210-5]
CCDS85239.1 [Q61210-2]
RefSeqiNP_001123622.1, NM_001130150.1 [Q61210-5]
NP_001123623.1, NM_001130151.1
NP_001123624.1, NM_001130152.1 [Q61210-1]
NP_001123625.1, NM_001130153.1 [Q61210-1]
NP_032514.1, NM_008488.2 [Q61210-2]

3D structure databases

SMRiQ61210
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi201115, 6 interactors
IntActiQ61210, 12 interactors
MINTiQ61210
STRINGi10090.ENSMUSP00000096280

PTM databases

iPTMnetiQ61210
PhosphoSitePlusiQ61210
SwissPalmiQ61210

Proteomic databases

EPDiQ61210
jPOSTiQ61210
PeptideAtlasiQ61210
PRIDEiQ61210

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
2765, 261 antibodies

Genome annotation databases

EnsembliENSMUST00000047873; ENSMUSP00000046469; ENSMUSG00000040940 [Q61210-1]
ENSMUST00000098683; ENSMUSP00000096280; ENSMUSG00000040940 [Q61210-5]
ENSMUST00000117419; ENSMUSP00000113366; ENSMUSG00000040940 [Q61210-1]
ENSMUST00000206508; ENSMUSP00000146314; ENSMUSG00000040940 [Q61210-2]
GeneIDi16801
KEGGimmu:16801
UCSCiuc009fqv.2, mouse [Q61210-2]
uc009fqw.2, mouse [Q61210-5]
uc009fqy.2, mouse [Q61210-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9138
MGIiMGI:1353510, Arhgef1

Phylogenomic databases

eggNOGiKOG3520, Eukaryota
GeneTreeiENSGT00940000161180
HOGENOMiCLU_003962_2_0_1
InParanoidiQ61210
KOiK12330
OMAiPAHLMAF
OrthoDBi319635at2759
PhylomeDBiQ61210
TreeFamiTF106495

Enzyme and pathway databases

ReactomeiR-MMU-193648, NRAGE signals death through JNK
R-MMU-194840, Rho GTPase cycle
R-MMU-416482, G alpha (12/13) signalling events

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
16801, 4 hits in 19 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Arhgef1, mouse

Protein Ontology

More...
PROi
PR:Q61210
RNActiQ61210, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000040940, Expressed in granulocyte and 289 other tissues
GenevisibleiQ61210, MM

Family and domain databases

CDDicd08755, RGS_p115RhoGEF, 1 hit
cd00160, RhoGEF, 1 hit
Gene3Di1.20.900.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR035899, DBL_dom_sf
IPR000219, DH-domain
IPR037887, p115RhoGEF_RGS
IPR011993, PH-like_dom_sf
IPR041020, PH_16
IPR001849, PH_domain
IPR015212, RGS-like_dom
IPR036305, RGS_sf
PfamiView protein in Pfam
PF17838, PH_16, 1 hit
PF09128, RGS-like, 1 hit
PF00621, RhoGEF, 1 hit
SMARTiView protein in SMART
SM00233, PH, 1 hit
SM00325, RhoGEF, 1 hit
SUPFAMiSSF48065, SSF48065, 1 hit
SSF48097, SSF48097, 1 hit
PROSITEiView protein in PROSITE
PS50010, DH_2, 1 hit
PS50003, PH_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiARHG1_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q61210
Secondary accession number(s): O89074
, Q3T9Q7, Q80YE8, Q80YE9, Q91VL3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 29, 2003
Last sequence update: August 29, 2003
Last modified: August 12, 2020
This is version 159 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again