Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Presenilin-2

Gene

Psen2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Probable catalytic subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein). Requires the other members of the gamma-secretase complex to have a protease activity. May play a role in intracellular signaling and gene expression or in linking chromatin to the nuclear membrane. May function in the cytoplasmic partitioning of proteins (By similarity).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei263By similarity1
Active sitei366By similarity1

GO - Molecular functioni

  • aspartic endopeptidase activity, intramembrane cleaving Source: InterPro
  • endopeptidase activity Source: MGI

GO - Biological processi

Keywordsi

Molecular functionHydrolase, Protease
Biological processNotch signaling pathway

Protein family/group databases

MEROPSiA22.002

Names & Taxonomyi

Protein namesi
Recommended name:
Presenilin-2 (EC:3.4.23.-)
Short name:
PS-2
Cleaved into the following 2 chains:
Gene namesi
Name:Psen2
Synonyms:Ad4h, Alg3, Ps-2, Psnl2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:109284 Psen2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 87CytoplasmicSequence analysisAdd BLAST87
Transmembranei88 – 108HelicalSequence analysisAdd BLAST21
Topological domaini109 – 138LumenalSequence analysisAdd BLAST30
Transmembranei139 – 159HelicalSequence analysisAdd BLAST21
Topological domaini160 – 166CytoplasmicSequence analysis7
Transmembranei167 – 187HelicalSequence analysisAdd BLAST21
Topological domaini188 – 200LumenalSequence analysisAdd BLAST13
Transmembranei201 – 221HelicalSequence analysisAdd BLAST21
Topological domaini222 – 223CytoplasmicSequence analysis2
Transmembranei224 – 244HelicalSequence analysisAdd BLAST21
Topological domaini245 – 249LumenalSequence analysis5
Transmembranei250 – 270HelicalSequence analysisAdd BLAST21
Topological domaini271 – 358CytoplasmicSequence analysisAdd BLAST88
Transmembranei359 – 379HelicalSequence analysisAdd BLAST21
Topological domaini380 – 388LumenalSequence analysis9
Transmembranei389 – 409HelicalSequence analysisAdd BLAST21
Topological domaini410 – 413CytoplasmicSequence analysis4
Intramembranei414 – 434HelicalSequence analysisAdd BLAST21
Topological domaini435 – 448CytoplasmicSequence analysisAdd BLAST14

Keywords - Cellular componenti

Endoplasmic reticulum, Golgi apparatus, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000256071 – 297Presenilin-2 NTF subunitBy similarityAdd BLAST297
ChainiPRO_0000025608298 – 448Presenilin-2 CTF subunitAdd BLAST151

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei22PhosphoserineCombined sources1
Modified residuei25PhosphoserineCombined sources1
Modified residuei30PhosphoserineCombined sources1
Modified residuei52PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ61144
PeptideAtlasiQ61144
PRIDEiQ61144

PTM databases

iPTMnetiQ61144
PhosphoSitePlusiQ61144

Expressioni

Tissue specificityi

Ubiquitously expressed. Highly expressed in the liver.

Gene expression databases

CleanExiMM_PSEN2

Interactioni

Subunit structurei

Homodimer. Component of the gamma-secretase complex, a complex composed of a presenilin homodimer (PSEN1 or PSEN2), nicastrin (NCSTN), APH1 (APH1A or APH1B) and PEN2. Such minimal complex is sufficient for secretase activity, although other components may exist. Interacts with DOCK3. Interacts with HERPUD1, FLNA, FLNB and PARL (By similarity).By similarity

Protein-protein interaction databases

BioGridi202415, 11 interactors
IntActiQ61144, 1 interactor
STRINGi10090.ENSMUSP00000010753

Structurei

3D structure databases

ProteinModelPortaliQ61144
SMRiQ61144
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi414 – 416PAL3

Domaini

The PAL motif is required for normal active site conformation.By similarity

Sequence similaritiesi

Belongs to the peptidase A22A family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2736 Eukaryota
ENOG410XPZD LUCA
HOGENOMiHOG000240228
HOVERGENiHBG011375
InParanoidiQ61144
KOiK04522
PhylomeDBiQ61144

Family and domain databases

InterProiView protein in InterPro
IPR001493 Pept_A22A_PS2
IPR001108 Peptidase_A22A
IPR006639 Preselin/SPP
PANTHERiPTHR10202 PTHR10202, 2 hits
PfamiView protein in Pfam
PF01080 Presenilin, 2 hits
PRINTSiPR01072 PRESENILIN
PR01074 PRESENILIN2
SMARTiView protein in SMART
SM00730 PSN, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q61144-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLAFMASDSE EEVCDERTSL MSAESPTSRS CQEGRPGPED GESTAQWRTQ
60 70 80 90 100
ESEEDCEEDP DRYACSGAPG RPSGLEEELT LKYGAKRVIM LFVPVTLCMI
110 120 130 140 150
VVVATIKSVR FYTEKNGQLI YTPFTEDTPS VGQRLLNSVL NTLIMISVIV
160 170 180 190 200
VMTIFLVVLY KYRCYKFIHG WLIMSSLMLL FLFTYIYLGE VLKTYNVAMD
210 220 230 240 250
YPTLFLAVWN FGAVGMVCIH WKGPLVLQQA YLIVISALMA LVFIKYLPEW
260 270 280 290 300
SAWVILGAIS VYDLVAVLCP KGPLRMLVET AQERNEPIFP ALIYSSAMVW
310 320 330 340 350
TVGMAKLDPS SQGALQLPYD PEMEEDSYDS FGEPSYPEAF EAPLPGYPGE
360 370 380 390 400
ELEEEEERGV KLGLGDFIFY SVLVGKAAAT GNGDWNTTLA CFIAILIGLC
410 420 430 440
LTLLLLAVFK KALPALPISI TFGLIFYFST DNLVRPFMDT LASHQLYI
Length:448
Mass (Da):49,983
Last modified:September 26, 2003 - v3
Checksum:i54787212DCBB2C78
GO
Isoform 2 (identifier: Q61144-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     296-332: SAMVWTVGMAKLDPSSQGALQLPYDPEMEEDSYDSFG → CEWSHASARHWGVSRWPFVEAWKWAVVLISDRLYILS
     333-448: Missing.

Note: No experimental confirmation available.
Show »
Length:332
Mass (Da):37,701
Checksum:iE598A662F7EA7D0C
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q3U4P5Q3U4P5_MOUSE
Presenilin
Psen2 mCG_6223
448Annotation score:
A0A0R4J1F2A0A0R4J1F2_MOUSE
Presenilin
Psen2
447Annotation score:
D3Z0X1D3Z0X1_MOUSE
Presenilin-2
Psen2
39Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti40D → G in BAB29514 (PubMed:16141072).Curated1
Sequence conflicti86 – 87KR → ND in BAB29514 (PubMed:16141072).Curated2
Sequence conflicti87R → H (Ref. 2) Curated1
Sequence conflicti87R → H (PubMed:15489334).Curated1
Sequence conflicti226V → A in AAC52937 (PubMed:8940094).Curated1
Sequence conflicti324Missing in AAB92660 (Ref. 2) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_008383296 – 332SAMVW…YDSFG → CEWSHASARHWGVSRWPFVE AWKWAVVLISDRLYILS in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_008384333 – 448Missing in isoform 2. 1 PublicationAdd BLAST116

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U57324 mRNA Translation: AAC52937.1
U57325 mRNA Translation: AAC53311.1
AF038935 mRNA Translation: AAB92660.1
AK014706 mRNA Translation: BAB29514.1
BC010403 mRNA Translation: AAH10403.1
U49111 mRNA Translation: AAC52935.1
CCDSiCCDS15567.1 [Q61144-1]
RefSeqiNP_001122077.1, NM_001128605.1
NP_035313.2, NM_011183.3
XP_006496775.1, XM_006496712.2
XP_011237078.1, XM_011238776.2
UniGeneiMm.330850

Genome annotation databases

GeneIDi19165
KEGGimmu:19165
UCSCiuc007dwe.1 mouse [Q61144-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U57324 mRNA Translation: AAC52937.1
U57325 mRNA Translation: AAC53311.1
AF038935 mRNA Translation: AAB92660.1
AK014706 mRNA Translation: BAB29514.1
BC010403 mRNA Translation: AAH10403.1
U49111 mRNA Translation: AAC52935.1
CCDSiCCDS15567.1 [Q61144-1]
RefSeqiNP_001122077.1, NM_001128605.1
NP_035313.2, NM_011183.3
XP_006496775.1, XM_006496712.2
XP_011237078.1, XM_011238776.2
UniGeneiMm.330850

3D structure databases

ProteinModelPortaliQ61144
SMRiQ61144
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi202415, 11 interactors
IntActiQ61144, 1 interactor
STRINGi10090.ENSMUSP00000010753

Protein family/group databases

MEROPSiA22.002

PTM databases

iPTMnetiQ61144
PhosphoSitePlusiQ61144

Proteomic databases

PaxDbiQ61144
PeptideAtlasiQ61144
PRIDEiQ61144

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi19165
KEGGimmu:19165
UCSCiuc007dwe.1 mouse [Q61144-2]

Organism-specific databases

CTDi5664
MGIiMGI:109284 Psen2

Phylogenomic databases

eggNOGiKOG2736 Eukaryota
ENOG410XPZD LUCA
HOGENOMiHOG000240228
HOVERGENiHBG011375
InParanoidiQ61144
KOiK04522
PhylomeDBiQ61144

Miscellaneous databases

ChiTaRSiPsen2 mouse
PROiPR:Q61144
SOURCEiSearch...

Gene expression databases

CleanExiMM_PSEN2

Family and domain databases

InterProiView protein in InterPro
IPR001493 Pept_A22A_PS2
IPR001108 Peptidase_A22A
IPR006639 Preselin/SPP
PANTHERiPTHR10202 PTHR10202, 2 hits
PfamiView protein in Pfam
PF01080 Presenilin, 2 hits
PRINTSiPR01072 PRESENILIN
PR01074 PRESENILIN2
SMARTiView protein in SMART
SM00730 PSN, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPSN2_MOUSE
AccessioniPrimary (citable) accession number: Q61144
Secondary accession number(s): O54977
, P97934, P97935, Q91VS3, Q9D616
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: September 26, 2003
Last modified: November 7, 2018
This is version 167 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again