Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 165 (08 May 2019)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Tuberin

Gene

Tsc2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

In complex with TSC1, this tumor suppressor inhibits the nutrient-mediated or growth factor-stimulated phosphorylation of S6K1 and EIF4EBP1 by negatively regulating mTORC1 signaling (By similarity). Acts as a GTPase-activating protein (GAP) for the small GTPase RHEB, a direct activator of the protein kinase activity of mTORC1 (By similarity). May also play a role in microtubule-mediated protein transport (PubMed:16707451). Also stimulates the intrinsic GTPase activity of the Ras-related proteins RAP1A and RAB5 (By similarity).By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGTPase activation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-1632852 Macroautophagy
R-MMU-165181 Inhibition of TSC complex formation by PKB
R-MMU-198323 AKT phosphorylates targets in the cytosol
R-MMU-380972 Energy dependent regulation of mTOR by LKB1-AMPK
R-MMU-5628897 TP53 Regulates Metabolic Genes
R-MMU-8854214 TBC/RABGAPs

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tuberin
Alternative name(s):
Tuberous sclerosis 2 protein homolog
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Tsc2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:102548 Tsc2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Keywords - Diseasei

Tumor suppressor

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000656551 – 1814TuberinAdd BLAST1814

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei540PhosphoserineBy similarity1
Modified residuei664PhosphoserineBy similarity1
Modified residuei927PhosphothreonineBy similarity1
Modified residuei939Phosphoserine; by PKB/AKT1By similarity1
Modified residuei981PhosphoserineBy similarity1
Modified residuei1132PhosphoserineCombined sources1
Modified residuei1155PhosphoserineBy similarity1
Modified residuei1270PhosphothreonineBy similarity1
Modified residuei1339PhosphoserineBy similarity1
Modified residuei1340PhosphoserineBy similarity1
Modified residuei1348PhosphoserineBy similarity1
Modified residuei1365PhosphoserineBy similarity1
Modified residuei1388PhosphoserineBy similarity1
Modified residuei1412PhosphoserineBy similarity1
Modified residuei1419PhosphoserineBy similarity1
Modified residuei1421PhosphoserineBy similarity1
Modified residuei1455PhosphoserineBy similarity1
Modified residuei1465Phosphothreonine; by PKB/AKT1By similarity1
Modified residuei1772PhosphoserineCombined sources1
Modified residuei1805Phosphoserine; by RPS6KA1By similarity1
Modified residuei1806PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation at Ser-1388, Ser-1419 or Ser-1421 does not affect interaction with TSC1. Phosphorylation at Ser-939 and Thr-1465 by PKB/AKT1 is induced by growth factor stimulation. Phosphorylation by AMPK activates it and leads to negatively regulates the mTORC1 complex. Phosphorylated at Ser-1805 by RPS6KA1; phosphorylation inhibits TSC2 ability to suppress mTORC1 signaling. Phosphorylated by DAPK1.By similarity
Ubiquitinated by the DCX(FBXW5) E3 ubiquitin-protein ligase complex, leading to its subsequent degradation. Ubiquitinated by MYCBP2 independently of its phosphorylation status leading to subsequent degradation; association with TSC1 protects from ubiquitination.By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q61037

PeptideAtlas

More...
PeptideAtlasi
Q61037

PRoteomics IDEntifications database

More...
PRIDEi
Q61037

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q61037

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q61037

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed.

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Probably forms a complex composed of chaperones HSP90 and HSP70, co-chaperones STIP1/HOP, CDC37, PPP5C, PTGES3/p23, TSC1 and client protein TSC2. Probably forms a complex composed of chaperones HSP90 and HSP70, co-chaperones CDC37, PPP5C, TSC1 and client protein TSC2, CDK4, AKT, RAF1 and NR3C1; this complex does not contain co-chaperones STIP1/HOP and PTGES3/p23. Forms a complex containing HSP90AA1, TSC1 and TSC2; TSC1 is required to recruit TCS2 to the complex thereby stabilizing TSC2. Interacts with TSC1 and HERC1; the interaction with TSC1 stabilizes TSC2 and prevents the interaction with HERC1. May also interact with the adapter molecule RABEP1. The final complex may contain TSC2 and RABEP1 linked to RAB5. Interacts with HSPA1 and HSPA8. Interacts with DAPK1. Interacts with FBXW5. Interacts with NAA10 (via C-terminal domain). Interacts with RRAGA (polyubiquitinated). Interacts with WDR45B (By similarity).By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
Tsc1Q9EP536EBI-7924402,EBI-1202690

GO - Molecular functioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q61037, 5 interactors

Molecular INTeraction database

More...
MINTi
Q61037

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000094986

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1532 – 1766Rap-GAPPROSITE-ProRule annotationAdd BLAST235

Phylogenomic databases

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q61037

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q61037

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.11210, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016024 ARM-type_fold
IPR035974 Rap/Ran-GAP_sf
IPR000331 Rap_GAP_dom
IPR003913 Tuberin
IPR018515 Tuberin-type_domain
IPR027107 Tuberin/Ral-act_asu
IPR024584 Tuberin_N

The PANTHER Classification System

More...
PANTHERi
PTHR10063 PTHR10063, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF11864 DUF3384, 1 hit
PF02145 Rap_GAP, 1 hit
PF03542 Tuberin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01431 TUBERIN

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF111347 SSF111347, 1 hit
SSF48371 SSF48371, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50085 RAPGAP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform G (identifier: Q61037-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAKPTSKDSG LKEKFKILLG LGTSRPNPRC AEGKQTEFII TSEILRELSG
60 70 80 90 100
ECGLNNRIRM IGQICDVAKT KKLEEHAVEA LWKAVSDLLQ PERPPEARHA
110 120 130 140 150
VLTLLKAIVQ GQGDRLGVLR ALFFKVIKDY PSNEDLHERL EVFKALTDNG
160 170 180 190 200
RHITYLEEEL AEFVLQWMDV GLSSEFLLVL VNLVKFNSCY LDEYIASMVH
210 220 230 240 250
MICLLCIRTV SSVDIEVSLQ VLDAVVCYNC LPAESLPLFI ITLCRTINVK
260 270 280 290 300
ELCEPCWKLM RNLLGTHLGH SAIYNMCRIM EDRSYMEDAP LLRGAVFFVG
310 320 330 340 350
MALWGAHRLY SLKNSPTSVL PSFYEAMTCP NEVVSYEIVL SITRLIKKYR
360 370 380 390 400
KELQAVTWDI LLDIIERLLQ QLQNLDSPEL KTIVHDLLTT VEELCDQNEF
410 420 430 440 450
HGSQERYYEL VESYADQRPE SSLLNLISYR AQSIHPAKDG WIQNLQLLME
460 470 480 490 500
RFFRNECRSA VAIKVLDVLS FVLLIIRQFY EEELINSVVI SQLSHIPEDK
510 520 530 540 550
DHQVRKLATQ LLVDLAEGCH THHFNSLLDI IEKVMARSLS PPPELEERDL
560 570 580 590 600
AVHSASLEDV KTAVLGLLVI LQTKLYTLPA SHATRVYESL ISHIQLHYKH
610 620 630 640 650
GYSLPIASSI RLQAFDFLLL LRADSLHRLG LPNKDGVVRF SPYCLCDCME
660 670 680 690 700
LDRASEKKAS GPLSPPTGPP SPVPMGPAVR LGYLPYSLLF RVLLQCLKQE
710 720 730 740 750
SDWKVLKLVL SRLPESLRYK VLIFTSPCSV DQLSSALCSM LSAPKTLERL
760 770 780 790 800
RGTPEGFSRT DLHLAVVPVL TALISYHNYL DKTRQREMVY CLEQGLIYRC
810 820 830 840 850
ASQCVVALAI CSVEMPDIII KALPVLVVKL THISATASMA IPLLEFLSTL
860 870 880 890 900
ARLPHLYRNF VPEQYASVFA ISLPYTNPSK FNQYIVCLAH HVIAMWFIRC
910 920 930 940 950
RLPFRKDFVP YITKGLRSNV LLSFDDTPEK DSFRARSTSL NERPKSLRIA
960 970 980 990 1000
RAPKQGLNNS PPVKEFKESC AAEAFRCRSI SVSEHVVRSR IQTSLTSASL
1010 1020 1030 1040 1050
GSADENSMAQ ADDNLKNLHL ELTETCLDMM ARYVFSNFTA VPKRSPVGEF
1060 1070 1080 1090 1100
LLAGGRTKTW LVGNKLVTVT TSVGTGTRSL LGLDSGDLQG GSDSSSDPST
1110 1120 1130 1140 1150
HVRQTKEAPA KLESQAGQQV SRGARDRVRS MSGGHGLRVG VLDTSAPYSP
1160 1170 1180 1190 1200
GGSASLGPQT AVAAKPEKPP AGAQLPTAEK TNLAAYVPLL TQGWAEILVR
1210 1220 1230 1240 1250
RPTGNTSWLM SLENPLSPFS SDINNMPLQE LSNALMAAER FKEHGHAPVQ
1260 1270 1280 1290 1300
VIVSATGCTA KPPTLPRSNT VASFSSLYQP SCQGQLHRSV SWADSAMVLE
1310 1320 1330 1340 1350
EGSPGETQVP VEPPELEDFE AALGTDRHCQ RPDTYSRSSS ASSQEEKSHL
1360 1370 1380 1390 1400
EELAAGGIPI ERAISSEGAR PAVDLSFQPS QPLSKSSSSP ELQTLQDILG
1410 1420 1430 1440 1450
DLGDKIDIGR LSPEAKVRSQ SGILDGEAAT WSATGEESRI TVPPEGPLPS
1460 1470 1480 1490 1500
SSPRSPSGLR PRGYTISDSA PSRRGKRVER DNFKSRAAAS SAEKVPGINP
1510 1520 1530 1540 1550
SFVFLQLYHS PFFGDESNKP ILLPNESFER SVQLLDQIPS YDTHKIAVLY
1560 1570 1580 1590 1600
VGEGQSSSEL AILSNEHGSY RYTEFLTGLG RLIELKDCQP DKVYLGGLDV
1610 1620 1630 1640 1650
CGEDGQFTYC WHDDIMQAVF HIATLMPTKD VDKHRCDKKR HLGNDFVSII
1660 1670 1680 1690 1700
YNDSGEDFKL GTIKQGQFNF VHVIITPLDY KCNLLTLQCR KDGPACKCEW
1710 1720 1730 1740 1750
WRQPGEIVVW ALPVVMELTV TILLCHLQMA SQVHHSRSNP TDIYPSKWIA
1760 1770 1780 1790 1800
RLRHIKRLRQ RIREEVHYSN PSLPLMHPPA HTKAPAQAPE ATPTYETGQR
1810
KRLISSVDDF TEFV
Length:1,814
Mass (Da):202,071
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i913AB87194AADA5B
GO
Isoform A (identifier: Q61037-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     79-115: Missing.

Show »
Length:1,777
Mass (Da):197,982
Checksum:iEC1013448D7CECCE
GO
Isoform B (identifier: Q61037-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     534-572: Missing.

Show »
Length:1,775
Mass (Da):197,891
Checksum:i9D54C4EF90B89C4E
GO
Isoform C (identifier: Q61037-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     947-990: Missing.

Show »
Length:1,770
Mass (Da):197,163
Checksum:i6BA34A440D4378C6
GO
Isoform D (identifier: Q61037-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1271-1293: Missing.

Show »
Length:1,791
Mass (Da):199,550
Checksum:iE616D6579FAF310F
GO
Isoform E (identifier: Q61037-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1245-1258: GHAPVQVIVSATGC → RDTALYKSLSVPAAG
     1271-1293: Missing.
     1693-1728: GPACKCEWWRQPGEIVVWALPVVMELTVTILLCHLQ → MEGLVDTSVAKIVSDRNLSFVARQMALHAN

Show »
Length:1,786
Mass (Da):198,914
Checksum:iEDC8768C66FBFE76
GO
Isoform F (identifier: Q61037-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     947-989: Missing.
     1245-1258: GHAPVQVIVSATGC → RDTALYKSLSVPAAG
     1271-1293: Missing.
     1693-1728: GPACKCEWWRQPGEIVVWALPVVMELTVTILLCHLQ → MEGLVDTSVAKIVSDRNLSFVARQMALHAN
     1776-1814: Missing.

Show »
Length:1,704
Mass (Da):189,855
Checksum:iF6A528C77739AE59
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q7TT21Q7TT21_MOUSE
Tuberin
Tsc2
1,742Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q3UHB2Q3UHB2_MOUSE
Tuberin
Tsc2
1,808Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2I3BRT5A0A2I3BRT5_MOUSE
Tuberin
Tsc2
1,741Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2I3BPP1A0A2I3BPP1_MOUSE
Tuberin
Tsc2
1,785Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2I3BPE9A0A2I3BPE9_MOUSE
Tuberin
Tsc2
1,359Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q3TQ10Q3TQ10_MOUSE
Tuberin
Tsc2
237Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2I3BRA1A0A2I3BRA1_MOUSE
Tuberin
Tsc2
7Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2I3BPR7A0A2I3BPR7_MOUSE
Tuberin
Tsc2
97Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti161Missing in AAA86902 (PubMed:8833243).Curated1
Sequence conflicti161Missing in AAA86901 (PubMed:8833243).Curated1
Sequence conflicti269G → S in AAA86902 (PubMed:8833243).Curated1
Sequence conflicti269G → S in AAA86901 (PubMed:8833243).Curated1
Sequence conflicti462A → R in AAA86902 (PubMed:8833243).Curated1
Sequence conflicti462A → R in AAA86901 (PubMed:8833243).Curated1
Sequence conflicti476I → N in AAA86902 (PubMed:8833243).Curated1
Sequence conflicti476I → N in AAA86901 (PubMed:8833243).Curated1
Sequence conflicti549D → N in AAA86902 (PubMed:8833243).Curated1
Sequence conflicti549D → N in AAA86901 (PubMed:8833243).Curated1
Sequence conflicti707K → N in AAD27867 (PubMed:10584558).Curated1
Sequence conflicti861 – 862VP → AA in AAA86902 (PubMed:8833243).Curated2
Sequence conflicti861 – 862VP → AA in AAA86901 (PubMed:8833243).Curated2
Sequence conflicti1127R → P in AAA86902 (PubMed:8833243).Curated1
Sequence conflicti1127R → P in AAA86901 (PubMed:8833243).Curated1
Sequence conflicti1665Missing in AAA86902 (PubMed:8833243).Curated1
Sequence conflicti1665Missing in AAA86901 (PubMed:8833243).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_00447379 – 115Missing in isoform A. CuratedAdd BLAST37
Alternative sequenceiVSP_004474534 – 572Missing in isoform B. CuratedAdd BLAST39
Alternative sequenceiVSP_004476947 – 990Missing in isoform C. CuratedAdd BLAST44
Alternative sequenceiVSP_004475947 – 989Missing in isoform F. CuratedAdd BLAST43
Alternative sequenceiVSP_0044771245 – 1258GHAPV…SATGC → RDTALYKSLSVPAAG in isoform E and isoform F. CuratedAdd BLAST14
Alternative sequenceiVSP_0044781271 – 1293Missing in isoform D, isoform E and isoform F. CuratedAdd BLAST23
Alternative sequenceiVSP_0044791693 – 1728GPACK…LCHLQ → MEGLVDTSVAKIVSDRNLSF VARQMALHAN in isoform E and isoform F. CuratedAdd BLAST36
Alternative sequenceiVSP_0044801776 – 1814Missing in isoform F. CuratedAdd BLAST39

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U37775 mRNA Translation: AAA86902.1
U37775 mRNA Translation: AAA86901.1
U39818 mRNA Translation: AAB18754.1
AB009371 Genomic DNA Translation: BAA28845.1
AF132986 mRNA Translation: AAD27867.1

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U37775 mRNA Translation: AAA86902.1
U37775 mRNA Translation: AAA86901.1
U39818 mRNA Translation: AAB18754.1
AB009371 Genomic DNA Translation: BAA28845.1
AF132986 mRNA Translation: AAD27867.1

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

IntActiQ61037, 5 interactors
MINTiQ61037
STRINGi10090.ENSMUSP00000094986

PTM databases

iPTMnetiQ61037
PhosphoSitePlusiQ61037

Proteomic databases

jPOSTiQ61037
PeptideAtlasiQ61037
PRIDEiQ61037

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Organism-specific databases

MGIiMGI:102548 Tsc2

Phylogenomic databases

InParanoidiQ61037
PhylomeDBiQ61037

Enzyme and pathway databases

ReactomeiR-MMU-1632852 Macroautophagy
R-MMU-165181 Inhibition of TSC complex formation by PKB
R-MMU-198323 AKT phosphorylates targets in the cytosol
R-MMU-380972 Energy dependent regulation of mTOR by LKB1-AMPK
R-MMU-5628897 TP53 Regulates Metabolic Genes
R-MMU-8854214 TBC/RABGAPs

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Tsc2 mouse

Protein Ontology

More...
PROi
PR:Q61037

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Family and domain databases

Gene3Di3.40.50.11210, 1 hit
InterProiView protein in InterPro
IPR016024 ARM-type_fold
IPR035974 Rap/Ran-GAP_sf
IPR000331 Rap_GAP_dom
IPR003913 Tuberin
IPR018515 Tuberin-type_domain
IPR027107 Tuberin/Ral-act_asu
IPR024584 Tuberin_N
PANTHERiPTHR10063 PTHR10063, 1 hit
PfamiView protein in Pfam
PF11864 DUF3384, 1 hit
PF02145 Rap_GAP, 1 hit
PF03542 Tuberin, 1 hit
PRINTSiPR01431 TUBERIN
SUPFAMiSSF111347 SSF111347, 1 hit
SSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS50085 RAPGAP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTSC2_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q61037
Secondary accession number(s): P97723
, P97724, P97725, P97727, Q61007, Q61008, Q9WUF6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: November 1, 1996
Last modified: May 8, 2019
This is version 165 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again