Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

T-cell differentiation antigen CD6

Gene

Cd6

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cell adhesion molecule that mediates cell-cell contacts and regulates T-cell responses via its interaction with ALCAM/CD166. Contributes to signaling cascades triggered by activation of the TCR/CD3 complex (PubMed:24584089). Functions as costimulatory molecule; promotes T-cell activation and proliferation. Contributes to the formation and maturation of the immunological synapse. Functions as calcium-dependent pattern receptor that binds and aggregates both Gram-positive and Gram-negative bacteria. Binds both lipopolysaccharide (LPS) from Gram-negative bacteria and lipoteichoic acid from Gram-positive bacteria. LPS binding leads to the activation of signaling cascades and down-stream MAP kinases. Mediates activation of the inflammatory response and the secretion of pro-inflammatory cytokines in response to LPS.By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell adhesion

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
T-cell differentiation antigen CD6
Alternative name(s):
CD_antigen: CD6
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Cd6
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:103566 Cd6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini17 – 398ExtracellularSequence analysisAdd BLAST382
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei399 – 419HelicalSequence analysisAdd BLAST21
Topological domaini420 – 665CytoplasmicSequence analysisAdd BLAST246

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 16Sequence analysisAdd BLAST16
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000003322817 – 665T-cell differentiation antigen CD6Add BLAST649

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi29N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi34N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi49N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi54 ↔ 87By similarity
Disulfide bondi69 ↔ 143PROSITE-ProRule annotation
Disulfide bondi82 ↔ 154PROSITE-ProRule annotation
Glycosylationi111N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi117N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi128 ↔ 136PROSITE-ProRule annotation
Disulfide bondi169 ↔ 203By similarity
Disulfide bondi185 ↔ 248PROSITE-ProRule annotation
Disulfide bondi198 ↔ 258PROSITE-ProRule annotation
Glycosylationi228N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi229 ↔ 239PROSITE-ProRule annotation
Disulfide bondi289 ↔ 349PROSITE-ProRule annotation
Disulfide bondi302 ↔ 359PROSITE-ProRule annotation
Disulfide bondi329 ↔ 339PROSITE-ProRule annotation
Glycosylationi344N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi367N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei659PhosphotyrosineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

After T-cell activation, becomes hyperphosphorylated on Ser and Thr residues (By similarity). Phosphorylated on tyrosine residues in response to stimulation of the TCR complex (PubMed:24584089).By similarity1 Publication
Glycosylated.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q61003

PeptideAtlas

More...
PeptideAtlasi
Q61003

PRoteomics IDEntifications database

More...
PRIDEi
Q61003

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q61003

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q61003

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed predominantly in thymus, lymph node and spleen.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000024670 Expressed in 38 organ(s), highest expression level in thymus

CleanEx database of gene expression profiles

More...
CleanExi
MM_CD6

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q61003 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q61003 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via extracellular domain) with ALCAM/CD166 (via extracellular domain) (PubMed:16914752). Interacts with the TCR/CD3 complex subunit CD3E. Interacts (via tyrosine phosphorylated C-terminus) with LCP2 (via SH2 domain) (PubMed:24584089). Interacts (via glycosylated extracellular domain) with LGALS1 and LGALS3. Interaction with LGALS1 or LGALS3 inhibits interaction with ALCAM (By similarity). Interacts with VAV1 (PubMed:24584089).By similarity2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
Lcp2Q607879EBI-12601992,EBI-5324248

GO - Molecular functioni

Protein-protein interaction databases

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q61003

Protein interaction database and analysis system

More...
IntActi
Q61003, 3 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000079172

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q61003

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q61003

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini45 – 155SRCR 1PROSITE-ProRule annotationAdd BLAST111
Domaini160 – 259SRCR 2PROSITE-ProRule annotationAdd BLAST100
Domaini264 – 360SRCR 3PROSITE-ProRule annotationAdd BLAST97

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IK9E Eukaryota
ENOG410YC2B LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161029

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000137917

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG005289

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q61003

KEGG Orthology (KO)

More...
KOi
K06456

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0DF7

TreeFam database of animal gene trees

More...
TreeFami
TF329295

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.10.250.10, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001190 SRCR
IPR017448 SRCR-like_dom
IPR036772 SRCR-like_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00530 SRCR, 3 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00258 SPERACTRCPTR

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00202 SR, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56487 SSF56487, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50287 SRCR_2, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q61003-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MWLFLGIAGL LTAVLSGLPS PAPSGQHKNG TIPNMTLDLE ERLGIRLVNG
60 70 80 90 100
SSRCSGSVKV LLESWEPVCA AHWNRAATEA VCKALNCGDS GKVTYLMPPT
110 120 130 140 150
SELPPGATSG NTSSAGNTTW ARAPTERCRG ANWQFCKVQD QECSSDRRLV
160 170 180 190 200
WVTCAENQAV RLVDGSSRCA GRVEMLEHGE WGTVCDDTWD LQDAHVVCKQ
210 220 230 240 250
LKCGWAVKAL AGLHFTPGQG PIHRDQVNCS GTEAYLWDCP GRPGDQYCGH
260 270 280 290 300
KEDAGVVCSE HQSWRLTGGI DSCEGQVEVY FRGVWSTVCD SEWYPSEAKV
310 320 330 340 350
LCRSLGCGSA VARPRGLPHS LDGRMYYSCK GQEPALSTCS WRFNNSNLCS
360 370 380 390 400
QSRAARVVCS GSQRHLNLST SEVPSRVPVT IESSVPVSVK DKDSQGLTLL
410 420 430 440 450
ILCIVLGILL LVSTIFIVIL LLRAKGQYAL PASVNHQQLS TANQAGINNY
460 470 480 490 500
HPVPITIAKE APMLFIQPRV PADSDSSSDS DYEHYDFSSQ PPVALTTFYN
510 520 530 540 550
SQRHRVTEEE AQQNRFQMPP LEEGLEELHV SHIPAADPRP CVADVPSRGS
560 570 580 590 600
QYHVRNNSDS STSSEEGYCN DPSSKPPPWN SQAFYSEKSP LTEQPPNLEL
610 620 630 640 650
AGSPAVFSGP SADDSSSTSS GEWYQNFQPP PQHPPAEQFE CPGPPGPQTD
660
SIDDDEEDYD DIGAA
Length:665
Mass (Da):72,255
Last modified:July 27, 2011 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8FF16DB37494D54F
GO
Isoform 2 (identifier: Q61003-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     557-586: NSDSSTSSEEGYCNDPSSKPPPWNSQAFYS → KDKASGVRAESWVEQTGSGHFLGVVKGHAG
     587-665: Missing.

Show »
Length:586
Mass (Da):63,726
Checksum:iC226D60556B8B8C6
GO
Isoform 3 (identifier: Q61003-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     461-500: APMLFIQPRVPADSDSSSDSDYEHYDFSSQPPVALTTFYN → D

Show »
Length:626
Mass (Da):67,892
Checksum:i65D37F72AFA14476
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3UZU7G3UZU7_MOUSE
T-cell differentiation antigen CD6
Cd6
327Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti5L → F in AAA64867 (PubMed:7870060).Curated1
Sequence conflicti8A → T in AAA64867 (PubMed:7870060).Curated1
Sequence conflicti194A → D in AAA81383 (PubMed:7594475).Curated1
Sequence conflicti194A → D in AAA81384 (PubMed:7594475).Curated1
Sequence conflicti316 – 317GL → AV in AAA81383 (PubMed:7594475).Curated2
Sequence conflicti316 – 317GL → AV in AAA81384 (PubMed:7594475).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_006224461 – 500APMLF…TTFYN → D in isoform 3. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_006225557 – 586NSDSS…QAFYS → KDKASGVRAESWVEQTGSGH FLGVVKGHAG in isoform 2. CuratedAdd BLAST30
Alternative sequenceiVSP_006226587 – 665Missing in isoform 2. CuratedAdd BLAST79

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U37543 mRNA Translation: AAA81383.1
U37544 mRNA Translation: AAA81384.1
U12434 mRNA Translation: AAA64867.1
AK030822 mRNA Translation: BAC27147.1
AK030823 mRNA Translation: BAC27148.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS37917.1 [Q61003-1]
CCDS50391.1 [Q61003-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
I49100

NCBI Reference Sequences

More...
RefSeqi
NP_001032890.1, NM_001037801.2 [Q61003-3]
NP_033982.3, NM_009852.3 [Q61003-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.290897

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000039043; ENSMUSP00000046861; ENSMUSG00000024670 [Q61003-3]
ENSMUST00000080292; ENSMUSP00000079172; ENSMUSG00000024670 [Q61003-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
12511

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:12511

UCSC genome browser

More...
UCSCi
uc008gqy.1 mouse [Q61003-1]
uc008gqz.1 mouse [Q61003-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U37543 mRNA Translation: AAA81383.1
U37544 mRNA Translation: AAA81384.1
U12434 mRNA Translation: AAA64867.1
AK030822 mRNA Translation: BAC27147.1
AK030823 mRNA Translation: BAC27148.1
CCDSiCCDS37917.1 [Q61003-1]
CCDS50391.1 [Q61003-3]
PIRiI49100
RefSeqiNP_001032890.1, NM_001037801.2 [Q61003-3]
NP_033982.3, NM_009852.3 [Q61003-1]
UniGeneiMm.290897

3D structure databases

ProteinModelPortaliQ61003
SMRiQ61003
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

CORUMiQ61003
IntActiQ61003, 3 interactors
STRINGi10090.ENSMUSP00000079172

PTM databases

iPTMnetiQ61003
PhosphoSitePlusiQ61003

Proteomic databases

PaxDbiQ61003
PeptideAtlasiQ61003
PRIDEiQ61003

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000039043; ENSMUSP00000046861; ENSMUSG00000024670 [Q61003-3]
ENSMUST00000080292; ENSMUSP00000079172; ENSMUSG00000024670 [Q61003-1]
GeneIDi12511
KEGGimmu:12511
UCSCiuc008gqy.1 mouse [Q61003-1]
uc008gqz.1 mouse [Q61003-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
923
MGIiMGI:103566 Cd6

Phylogenomic databases

eggNOGiENOG410IK9E Eukaryota
ENOG410YC2B LUCA
GeneTreeiENSGT00940000161029
HOGENOMiHOG000137917
HOVERGENiHBG005289
InParanoidiQ61003
KOiK06456
OrthoDBiEOG091G0DF7
TreeFamiTF329295

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q61003

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000024670 Expressed in 38 organ(s), highest expression level in thymus
CleanExiMM_CD6
ExpressionAtlasiQ61003 baseline and differential
GenevisibleiQ61003 MM

Family and domain databases

Gene3Di3.10.250.10, 3 hits
InterProiView protein in InterPro
IPR001190 SRCR
IPR017448 SRCR-like_dom
IPR036772 SRCR-like_dom_sf
PfamiView protein in Pfam
PF00530 SRCR, 3 hits
PRINTSiPR00258 SPERACTRCPTR
SMARTiView protein in SMART
SM00202 SR, 3 hits
SUPFAMiSSF56487 SSF56487, 3 hits
PROSITEiView protein in PROSITE
PS50287 SRCR_2, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCD6_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q61003
Secondary accession number(s): Q60679, Q61004, Q8BGK1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: July 27, 2011
Last modified: December 5, 2018
This is version 144 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again