UniProtKB - Q60980 (KLF3_MOUSE)

BLAST

>sp|Q60980|KLF3_MOUSE Krueppel-like factor 3 OS=Mus musculus OX=10090 GN=Klf3 PE=1 SV=1
MLMFDPVPVKQEAMDPVSVSFPSNYIESMKPNKYGVIYSTPLPDKFFQTPEGLTHGIQVE
PVDLTVNKRGSPPAAGGSPSSLKFPSHRRASPGLSMPSSSPPIKKYSPPSPGVQPFGVPL
SMPPVMAAALSRHGIRSPGILPVIQPVVVQPVPFMYTSHLQQPLMVSLSEEMDNSNSGMP
VPVIESYEKPLLQKKIKIEPGIEPQRTDYYPEEMSPPLMNPVSPPQALLQENHPSVIVQP
GKRPLPVESPDTQRKRRIHRCDYDGCNKVYTKSSHLKAHRRTHTGEKPYKCTWEGCTWKF
ARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHMLV

Align
Format
Add to basket Added to basket
History
Entry version 158 (07 Nov 2018)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Krueppel-like factor 3

Gene

Klf3

Organism

Mus musculus (Mouse)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Binds to the CACCC box of erythroid cell-expressed genes. May play a role in hematopoiesis.2 Publications

Regions

Feature key	Position(s)	DescriptionActions	Length
Zinc fingerⁱ	259 – 283	C2H2-type 1PROSITE-ProRule annotationAdd BLAST	25
Zinc fingerⁱ	289 – 313	C2H2-type 2PROSITE-ProRule annotationAdd BLAST	25
Zinc fingerⁱ	319 – 341	C2H2-type 3PROSITE-ProRule annotationAdd BLAST	23

GO - Molecular functionⁱ

DNA binding
Source: MGI
Inferred from sequence or structural similarityⁱ
- 15820306
DNA-binding transcription factor activity, RNA polymerase II-specific
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
DNA-binding transcription repressor activity, RNA polymerase II-specific Source: NTNU_SB
metal ion binding Source: UniProtKB-KW
RNA polymerase II regulatory region sequence-specific DNA binding
Source: NTNU_SB
Inferred from direct assayⁱ
- 22115574

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

cellular response to peptide Source: Ensembl
negative regulation of transcription by RNA polymerase II
Source: NTNU_SB
Inferred from mutant phenotypeⁱ
- 18687676
regulation of transcription by RNA polymerase II
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Activator, DNA-binding, Repressor
Biological process	Transcription, Transcription regulation
Ligand	Metal-binding, Zinc

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Krueppel-like factor 3 Alternative name(s): Basic krueppel-like factor CACCC-box-binding protein BKLF TEF-2
Gene namesⁱ	Name:Klf3 Synonyms:Bklf
Organismⁱ	Mus musculus (Mouse)
Taxonomic identifierⁱ	10090 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
Proteomesⁱ	UP000000589 Componentⁱ: Chromosome 5

Organism-specific databases

MGIⁱ	MGI:1342773 Klf3

Keywords - Cellular componentⁱ

Nucleus

Pathology & Biotechⁱ

Mutagenesis

Feature key	Position(s)	DescriptionActions	Length
Mutagenesisⁱ	10	K → A: Reduced sumoylation levels. No effect on DNA-binding and slight reduction of transcriptional repression. Abolishes sumoylation. No effect on DNA-binding but great reduction in transcriptional repression; when associated with A-197. 1 Publication	1
Mutagenesisⁱ	12	E → A: Slight reduction of transcriptional repression. Great reduction of transcriptional repression; when associated with A-199. 1 Publication	1
Mutagenesisⁱ	197	K → A: Reduced sumoylation levels. No effect on DNA-binding and slight reduction of transcriptional repression. Abolishes sumoylation. No effect on DNA-binding but great reduction of transcriptional repression; when associated with A-10. 1 Publication	1
Mutagenesisⁱ	199	E → A: Slight reduction of transcriptional repression. Great reduction of transcriptional repression; when associated with A-199. 1 Publication	1
Mutagenesisⁱ	341	H → A, D, E, N, Q or R: Little change in DNA-binding ability. 1 Publication	1

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000047166	1 – 344	Krueppel-like factor 3Add BLAST		344

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Cross-linkⁱ	10	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)1 Publication
Cross-linkⁱ	68	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residueⁱ	71	PhosphoserineBy similarity	1
Modified residueⁱ	91	PhosphoserineCombined sources	1
Modified residueⁱ	100	PhosphoserineCombined sources	1
Modified residueⁱ	107	PhosphoserineCombined sources	1
Modified residueⁱ	110	PhosphoserineCombined sources	1
Cross-linkⁱ	195	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linkⁱ	197	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO); alternate
Cross-linkⁱ	197	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateBy similarity
Modified residueⁱ	215	PhosphoserineCombined sources	1
Modified residueⁱ	223	PhosphoserineCombined sources	1
Modified residueⁱ	249	PhosphoserineBy similarity	1

Post-translational modificationⁱ

Sumoylated with SUMO1. Sumoylation is enhanced by PIAS1, PIAS2alpha and PIAS2beta, and PIAS4, but not by Pc2. Enhances transcriptional repression, but has no effect on DNA binding. Sumoylation on Lys-197 is the major site.1 Publication

Keywords - PTMⁱ

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQB - The MaxQuant DataBase More...MaxQBⁱ	Q60980
PaxDbⁱ	Q60980
PRIDEⁱ	Q60980

PTM databases

iPTMnetⁱ	Q60980
PhosphoSitePlusⁱ	Q60980

Expressionⁱ

Tissue specificityⁱ

In 8.5 day embryos, expressed in midbrain, anterior hindbrain and ventral forebrain. In 9 day embryos, expressed throughout ventral anterior half of embryo including midbrain-hindbrain junction, ventral midbrain, diencephalon and forebrain. At 10.5 days, distribution is more widespread with expression also found in developing limb buds. Widely expressed in the adult.1 Publication

Gene expression databases

Bgeeⁱ	ENSMUSG00000029178 Expressed in 297 organ(s), highest expression level in ear
CleanExⁱ	MM_KLF3
ExpressionAtlasⁱ	Q60980 baseline and differential
Genevisibleⁱ	Q60980 MM

Interactionⁱ

Subunit structureⁱ

Monomer.1 Publication

Protein-protein interaction databases

BioGridⁱ	200965, 2 interactors
STRINGⁱ	10090.ENSMUSP00000128429

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	316 – 319	Combined sources	4
Turnⁱ	322 – 324	Combined sources	3
Beta strandⁱ	328 – 330	Combined sources	3
Helixⁱ	331 – 338	Combined sources	8
Helixⁱ	339 – 341	Combined sources	3

Show more details

3D structure databases

ProteinModelPortalⁱ	Q60980
SMRⁱ	Q60980
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	Q60980

EvolutionaryTraceⁱ

Q60980

Family & Domainsⁱ

Region

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Regionⁱ	1 – 74	Repressor domainAdd BLAST		74

Motif

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Motifⁱ	61 – 65	CTBP-binding motif		5

Compositional bias

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Compositional biasⁱ	1 – 250	Pro-richAdd BLAST		250

Sequence similaritiesⁱ

Belongs to the krueppel C2H2-type zinc-finger protein family.Curated

Zinc finger

Feature key	Position(s)	DescriptionActions	Length
Zinc fingerⁱ	259 – 283	C2H2-type 1PROSITE-ProRule annotationAdd BLAST	25
Zinc fingerⁱ	289 – 313	C2H2-type 2PROSITE-ProRule annotationAdd BLAST	25
Zinc fingerⁱ	319 – 341	C2H2-type 3PROSITE-ProRule annotationAdd BLAST	23

Keywords - Domainⁱ

Repeat, Zinc-finger

Phylogenomic databases

eggNOGⁱ	KOG1721 Eukaryota COG5048 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00760000118998
HOGENOMⁱ	HOG000232138
HOVERGENⁱ	HBG003941
InParanoidⁱ	Q60980
KEGG Orthology (KO) More...KOⁱ	K15605
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G1BN0
PhylomeDBⁱ	Q60980
TreeFamⁱ	TF350556

Family and domain databases

InterProⁱ	View protein in InterPro IPR036236 Znf_C2H2_sf IPR013087 Znf_C2H2_type
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00096 zf-C2H2, 3 hits
SMARTⁱ	View protein in SMART SM00355 ZnF_C2H2, 3 hits
SUPFAMⁱ	SSF57667 SSF57667, 2 hits
PROSITEⁱ	View protein in PROSITE PS00028 ZINC_FINGER_C2H2_1, 3 hits PS50157 ZINC_FINGER_C2H2_2, 3 hits

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

This entry has 1 described isoform and 3 potential isoforms that are computationally mapped.Show all Align All

Q60980-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MLMFDPVPVK QEAMDPVSVS FPSNYIESMK PNKYGVIYST PLPDKFFQTP 
        60         70         80         90        100
EGLTHGIQVE PVDLTVNKRG SPPAAGGSPS SLKFPSHRRA SPGLSMPSSS 
       110        120        130        140        150
PPIKKYSPPS PGVQPFGVPL SMPPVMAAAL SRHGIRSPGI LPVIQPVVVQ 
       160        170        180        190        200
PVPFMYTSHL QQPLMVSLSE EMDNSNSGMP VPVIESYEKP LLQKKIKIEP 
       210        220        230        240        250
GIEPQRTDYY PEEMSPPLMN PVSPPQALLQ ENHPSVIVQP GKRPLPVESP 
       260        270        280        290        300
DTQRKRRIHR CDYDGCNKVY TKSSHLKAHR RTHTGEKPYK CTWEGCTWKF 
       310        320        330        340 
ARSDELTRHF RKHTGIKPFQ CPDCDRSFSR SDHLALHRKR HMLV

Length:344

Mass (Da):38,561

Last modified:November 1, 1996 - v1

Checksum:ⁱ2BB7E3B63A7C1D88

Computationally mapped potential isoform sequencesⁱ

There are 3 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

A0A0G2JE66	A0A0G2JE66_MOUSE	Krueppel-like factor 3 Krueppel-like factor 3	Klf3	138	Annotation score:
A0A0G2JE81	A0A0G2JE81_MOUSE	Krueppel-like factor 3 Krueppel-like factor 3	Klf3	55	Annotation score:
A0A0G2JDH4	A0A0G2JDH4_MOUSE	Krueppel-like factor 3 Krueppel-like factor 3	Klf3	142	Annotation score:

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U36340 mRNA Translation: AAA93256.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS19301.1
PIRⁱ	JC6100
NCBI Reference Sequences More...RefSeqⁱ	NP_032479.1, NM_008453.5 XP_006503814.1, XM_006503751.3
UniGeneⁱ	Mm.392759 Mm.439720

Genome annotation databases

Ensemblⁱ	ENSMUST00000165536; ENSMUSP00000129363; ENSMUSG00000029178 ENSMUST00000166409; ENSMUSP00000128429; ENSMUSG00000029178
GeneIDⁱ	16599
KEGGⁱ	mmu:16599
UCSC genome browser More...UCSCⁱ	uc008xmr.1 mouse

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q60980	Basic Kruppel-like transcription factor		MOUSE		344	UniRef100_Q60980
Krueppel-like factor 3 (Fragment)		MOUSE		142
Uncharacterized protein (Fragment)		MOUSE		274

Protein	Similar proteins		Species	Score	Length	Source
Q60980	Basic Kruppel-like transcription factor		MOUSE		344	UniRef90_Q60980
Uncharacterized protein		AOTNA		414
Krueppel-like factor 3		DIPOR		347
Kruppel-like factor 3		PIG		347
Krueppel-like factor 3		LIPVE		346
+79

Protein	Similar proteins		Species	Score	Length	Source
Q60980	Basic Kruppel-like transcription factor		MOUSE		344	UniRef50_Q60980
Uncharacterized protein		AOTNA		414
Kruppel-like factor 3		PIG		347
Krueppel-like factor 3		DIPOR		347
Uncharacterized protein		AILME		346
+130

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U36340 mRNA Translation: AAA93256.1
CCDSⁱ	CCDS19301.1
PIRⁱ	JC6100
RefSeqⁱ	NP_032479.1, NM_008453.5 XP_006503814.1, XM_006503751.3
UniGeneⁱ	Mm.392759 Mm.439720

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1P7A	NMR	-	A	314-344	[»]
	1U85	NMR	-	A	314-344	[»]
	1U86	NMR	-	A	314-344	[»]
ProteinModelPortalⁱ	Q60980
SMRⁱ	Q60980
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	200965, 2 interactors
STRINGⁱ	10090.ENSMUSP00000128429

PTM databases

iPTMnetⁱ	Q60980
PhosphoSitePlusⁱ	Q60980

Proteomic databases

MaxQBⁱ	Q60980
PaxDbⁱ	Q60980
PRIDEⁱ	Q60980

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENSMUST00000165536; ENSMUSP00000129363; ENSMUSG00000029178 ENSMUST00000166409; ENSMUSP00000128429; ENSMUSG00000029178
GeneIDⁱ	16599
KEGGⁱ	mmu:16599
UCSCⁱ	uc008xmr.1 mouse

Organism-specific databases

CTDⁱ	51274
MGIⁱ	MGI:1342773 Klf3

Phylogenomic databases

eggNOGⁱ	KOG1721 Eukaryota COG5048 LUCA
GeneTreeⁱ	ENSGT00760000118998
HOGENOMⁱ	HOG000232138
HOVERGENⁱ	HBG003941
InParanoidⁱ	Q60980
KOⁱ	K15605
OrthoDBⁱ	EOG091G1BN0
PhylomeDBⁱ	Q60980
TreeFamⁱ	TF350556

Miscellaneous databases

ChiTaRSⁱ	Klf3 mouse
EvolutionaryTraceⁱ	Q60980
Protein Ontology More...PROⁱ	PR:Q60980
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSMUSG00000029178 Expressed in 297 organ(s), highest expression level in ear
CleanExⁱ	MM_KLF3
ExpressionAtlasⁱ	Q60980 baseline and differential
Genevisibleⁱ	Q60980 MM

Family and domain databases

InterProⁱ	View protein in InterPro IPR036236 Znf_C2H2_sf IPR013087 Znf_C2H2_type
Pfamⁱ	View protein in Pfam PF00096 zf-C2H2, 3 hits
SMARTⁱ	View protein in SMART SM00355 ZnF_C2H2, 3 hits
SUPFAMⁱ	SSF57667 SSF57667, 2 hits
PROSITEⁱ	View protein in PROSITE PS00028 ZINC_FINGER_C2H2_1, 3 hits PS50157 ZINC_FINGER_C2H2_2, 3 hits
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	KLF3_MOUSE
Accessionⁱ	Q60980Primary (citable) accession number: Q60980
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	December 1, 2000
	Last sequence update:	November 1, 1996
	Last modified:	November 7, 2018
	This is version 158 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
MGD cross-references
Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q60980 (KLF3_MOUSE)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Krueppel-like factor 3

Klf3

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regions

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Nucleus

Nucleus

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Motif

Compositional bias

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ