UniProtKB - Q60773 (CDN2D_MOUSE)

BLAST

>sp|Q60773|CDN2D_MOUSE Cyclin-dependent kinase 4 inhibitor D OS=Mus musculus OX=10090 GN=Cdkn2d PE=1 SV=2
MLLEEVCVGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSPAVALEL
LKQGASPNVQDASGTSPVHDAARTGFLDTLKVLVEHGADVNALDSTGSLPIHLAIREGHS
SVVSFLAPESDLHHRDASGLTPLELARQRGAQNLMDILQGHMMIPM

Align
Format
Add to basket Added to basket
History
Entry version 144 (07 Nov 2018)
Sequence version 2 (03 Oct 2012)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Cyclin-dependent kinase 4 inhibitor D

Gene

Cdkn2d

Organism

Mus musculus (Mouse)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Interacts strongly with CDK4 and CDK6 and inhibits them.2 Publications

GO - Molecular functionⁱ

cyclin-dependent protein serine/threonine kinase inhibitor activity Source: MGI
protein kinase binding
Source: MGI
Inferred from physical interactionⁱ
- 7739547

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

autophagic cell death Source: MGI
cell cycle arrest Source: MGI
DNA synthesis involved in DNA repair Source: MGI
G1/S transition of mitotic cell cycle Source: MGI
negative regulation of cell cycle G1/S phase transition
Source: MGI
Inferred from direct assayⁱ
- 7739547
negative regulation of cell growth Source: MGI
negative regulation of cell proliferation Source: MGI
negative regulation of cysteine-type endopeptidase activity involved in apoptotic process Source: MGI
negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage Source: MGI
negative regulation of phosphorylation Source: MGI
regulation of cyclin-dependent protein serine/threonine kinase activity Source: MGI
response to retinoic acid Source: MGI
response to UV Source: MGI
response to vitamin D Source: MGI
sensory perception of sound
Source: MGI
Inferred from mutant phenotypeⁱ
- 12717441

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Biological process	Cell cycle

Biological process

Cell cycle

Enzyme and pathway databases

Reactomeⁱ	R-MMU-2559580 Oxidative Stress Induced Senescence R-MMU-2559582 Senescence-Associated Secretory Phenotype (SASP) R-MMU-2559585 Oncogene Induced Senescence R-MMU-69231 Cyclin D associated events in G1

Reactomeⁱ

R-MMU-2559580 Oxidative Stress Induced Senescence
R-MMU-2559582 Senescence-Associated Secretory Phenotype (SASP)
R-MMU-2559585 Oncogene Induced Senescence
R-MMU-69231 Cyclin D associated events in G1

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Cyclin-dependent kinase 4 inhibitor D Alternative name(s): p19-INK4d
Gene namesⁱ	Name:Cdkn2d
Organismⁱ	Mus musculus (Mouse)
Taxonomic identifierⁱ	10090 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
Proteomesⁱ	UP000000589 Componentⁱ: Chromosome 9

Organism-specific databases

MGIⁱ	MGI:105387 Cdkn2d

Keywords - Cellular componentⁱ

Cytoplasm, Nucleus

Pathology & Biotechⁱ

Keywords - Diseaseⁱ

Tumor suppressor

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000144189	1 – 166	Cyclin-dependent kinase 4 inhibitor DAdd BLAST		166

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Modified residueⁱ	1	N-acetylmethionineBy similarity		1

Keywords - PTMⁱ

Acetylation

Proteomic databases

EPDⁱ	Q60773
PaxDbⁱ	Q60773
PRIDEⁱ	Q60773

PTM databases

iPTMnetⁱ	Q60773
PhosphoSitePlusⁱ	Q60773

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSMUSG00000096472 Expressed in 282 organ(s), highest expression level in bone marrow
ExpressionAtlasⁱ	Q60773 baseline and differential
Genevisibleⁱ	Q60773 MM

Interactionⁱ

Subunit structureⁱ

Interacts with CDK6.By similarity

GO - Molecular functionⁱ

protein kinase binding
Source: MGI
Inferred from physical interactionⁱ
- 7739547

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

CORUMⁱ	Q60773
IntActⁱ	Q60773, 1 interactor
STRINGⁱ	10090.ENSMUSP00000083561

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Helixⁱ	7 – 17	Combined sources	11
Helixⁱ	21 – 29	Combined sources	9
Helixⁱ	45 – 48	Combined sources	4
Helixⁱ	54 – 62	Combined sources	9
Turnⁱ	72 – 74	Combined sources	3
Helixⁱ	77 – 84	Combined sources	8
Helixⁱ	87 – 95	Combined sources	9
Helixⁱ	110 – 117	Combined sources	8
Helixⁱ	120 – 126	Combined sources	7
Helixⁱ	127 – 129	Combined sources	3
Helixⁱ	142 – 148	Combined sources	7
Helixⁱ	152 – 160	Combined sources	9

Show more details

3D structure databases

ProteinModelPortalⁱ	Q60773
SMRⁱ	Q60773
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ

Q60773

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Length
Repeatⁱ	41 – 69	ANK 1Add BLAST	29
Repeatⁱ	73 – 102	ANK 2Add BLAST	30
Repeatⁱ	106 – 135	ANK 3Add BLAST	30
Repeatⁱ	138 – 165	ANK 4Add BLAST	28

Sequence similaritiesⁱ

Belongs to the CDKN2 cyclin-dependent kinase inhibitor family.Curated

Keywords - Domainⁱ

ANK repeat, Repeat

Phylogenomic databases

eggNOGⁱ	KOG0504 Eukaryota COG0666 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000004527
HOGENOMⁱ	HOG000290191
HOVERGENⁱ	HBG050870
InParanoidⁱ	Q60773
KEGG Orthology (KO) More...KOⁱ	K06623
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0PMC
TreeFamⁱ	TF333311

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd00204 ANK, 1 hit
Gene3Dⁱ	1.25.40.20, 1 hit
InterProⁱ	View protein in InterPro IPR002110 Ankyrin_rpt IPR020683 Ankyrin_rpt-contain_dom IPR036770 Ankyrin_rpt-contain_sf
SMARTⁱ	View protein in SMART SM00248 ANK, 3 hits
SUPFAMⁱ	SSF48403 SSF48403, 1 hit
PROSITEⁱ	View protein in PROSITE PS50297 ANK_REP_REGION, 1 hit PS50088 ANK_REPEAT, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

This entry has 1 described isoform and 2 potential isoforms that are computationally mapped.Show all Align All

Q60773-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MLLEEVCVGD RLSGAAARGD VQEVRRLLHR ELVHPDALNR FGKTALQVMM 
        60         70         80         90        100
FGSPAVALEL LKQGASPNVQ DASGTSPVHD AARTGFLDTL KVLVEHGADV 
       110        120        130        140        150
NALDSTGSLP IHLAIREGHS SVVSFLAPES DLHHRDASGL TPLELARQRG 
       160 
AQNLMDILQG HMMIPM

Length:166

Mass (Da):17,809

Last modified:October 3, 2012 - v2

Checksum:ⁱ7B95D6C2294F9259

Computationally mapped potential isoform sequencesⁱ

There are 2 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

A0A1L1SRJ2	A0A1L1SRJ2_MOUSE	Cyclin-dependent kinase 4 inhibitor... Cyclin-dependent kinase 4 inhibitor D	Cdkn2d	163	Annotation score:
A0A1N9MI08	A0A1N9MI08_MOUSE	Cyclin-dependent kinase 4 inhibitor... Cyclin-dependent kinase 4 inhibitor D	Cdkn2d	50	Annotation score:

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	16	A → R in AAC52194 (PubMed:7739547).Curated		1
Sequence conflictⁱ	17	A → P in AAA85437 (PubMed:7739548).Curated		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U19597 mRNA Translation: AAC52194.1 U20497 mRNA Translation: AAA85437.1 AK132906 mRNA Translation: BAE21414.1 AC122525 Genomic DNA No translation available. CH466522 Genomic DNA Translation: EDL25176.1 BC013898 mRNA Translation: AAH13898.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS22901.1
PIRⁱ	A57379 B57378
NCBI Reference Sequences More...RefSeqⁱ	NP_034008.2, NM_009878.3 XP_006510031.1, XM_006509968.1
UniGeneⁱ	Mm.29020

Genome annotation databases

Ensemblⁱ	ENSMUST00000215619; ENSMUSP00000150701; ENSMUSG00000096472
GeneIDⁱ	12581
KEGGⁱ	mmu:12581
UCSC genome browser More...UCSCⁱ	uc009okw.1 mouse

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q60773	Cyclin-dependent kinase 4 inhibitor D (Fragment)		MOUSE		163	UniRef100_Q60773
UPI00001105DD		MOUSE		168

Protein	Similar proteins		Species	Score	Length	Source
Q60773	Cyclin-dependent kinase 4 inhibitor D (Fragment)		MOUSE		163	UniRef90_Q60773
Similar to cyclin-dependent kinase inhibitor 2D		RAT		166
cyclin-dependent kinase 4 inhibitor D		MESAU		166
Cyclin-dependent kinase 4 inhibitor D		CRIGR		166
Uncharacterized protein		NEOLE		166
+6

Protein	Similar proteins		Species	Score	Length	Source
Q60773	Cyclin-dependent kinase 4 inhibitor D (Fragment)		MOUSE		163	UniRef50_Q60773
Similar to cyclin-dependent kinase inhibitor 2D		RAT		166
Uncharacterized protein		NEOLE		166
cyclin-dependent kinase 4 inhibitor D		MESAU		166
Cyclin-dependent kinase 4 inhibitor D		CRIGR		166
+140

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U19597 mRNA Translation: AAC52194.1 U20497 mRNA Translation: AAA85437.1 AK132906 mRNA Translation: BAE21414.1 AC122525 Genomic DNA No translation available. CH466522 Genomic DNA Translation: EDL25176.1 BC013898 mRNA Translation: AAH13898.1
CCDSⁱ	CCDS22901.1
PIRⁱ	A57379 B57378
RefSeqⁱ	NP_034008.2, NM_009878.3 XP_006510031.1, XM_006509968.1
UniGeneⁱ	Mm.29020

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1AP7	NMR	-	A	1-166	[»]
	1BLX	X-ray	1.90	B	1-166	[»]
ProteinModelPortalⁱ	Q60773
SMRⁱ	Q60773
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

CORUMⁱ	Q60773
IntActⁱ	Q60773, 1 interactor
STRINGⁱ	10090.ENSMUSP00000083561

PTM databases

iPTMnetⁱ	Q60773
PhosphoSitePlusⁱ	Q60773

Proteomic databases

EPDⁱ	Q60773
PaxDbⁱ	Q60773
PRIDEⁱ	Q60773

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENSMUST00000215619; ENSMUSP00000150701; ENSMUSG00000096472
GeneIDⁱ	12581
KEGGⁱ	mmu:12581
UCSCⁱ	uc009okw.1 mouse

Organism-specific databases

CTDⁱ	1032
MGIⁱ	MGI:105387 Cdkn2d

Phylogenomic databases

eggNOGⁱ	KOG0504 Eukaryota COG0666 LUCA
GeneTreeⁱ	ENSGT00390000004527
HOGENOMⁱ	HOG000290191
HOVERGENⁱ	HBG050870
InParanoidⁱ	Q60773
KOⁱ	K06623
OrthoDBⁱ	EOG091G0PMC
TreeFamⁱ	TF333311

Enzyme and pathway databases

Reactomeⁱ	R-MMU-2559580 Oxidative Stress Induced Senescence R-MMU-2559582 Senescence-Associated Secretory Phenotype (SASP) R-MMU-2559585 Oncogene Induced Senescence R-MMU-69231 Cyclin D associated events in G1

Reactomeⁱ

R-MMU-2559580 Oxidative Stress Induced Senescence
R-MMU-2559582 Senescence-Associated Secretory Phenotype (SASP)
R-MMU-2559585 Oncogene Induced Senescence
R-MMU-69231 Cyclin D associated events in G1

Miscellaneous databases

EvolutionaryTraceⁱ	Q60773
Protein Ontology More...PROⁱ	PR:Q60773
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSMUSG00000096472 Expressed in 282 organ(s), highest expression level in bone marrow
ExpressionAtlasⁱ	Q60773 baseline and differential
Genevisibleⁱ	Q60773 MM

Family and domain databases

CDDⁱ	cd00204 ANK, 1 hit
Gene3Dⁱ	1.25.40.20, 1 hit
InterProⁱ	View protein in InterPro IPR002110 Ankyrin_rpt IPR020683 Ankyrin_rpt-contain_dom IPR036770 Ankyrin_rpt-contain_sf
SMARTⁱ	View protein in SMART SM00248 ANK, 3 hits
SUPFAMⁱ	SSF48403 SSF48403, 1 hit
PROSITEⁱ	View protein in PROSITE PS50297 ANK_REP_REGION, 1 hit PS50088 ANK_REPEAT, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	CDN2D_MOUSE
Accessionⁱ	Q60773Primary (citable) accession number: Q60773 Secondary accession number(s): Q60794, Q91YV3
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	November 1, 1997
	Last sequence update:	October 3, 2012
	Last modified:	November 7, 2018
	This is version 144 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
MGD cross-references
Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q60773 (CDN2D_MOUSE)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Cyclin-dependent kinase 4 inhibitor D

Cdkn2d

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Nucleus

Other locations

Cytosol

Nucleus

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Keywords - Diseasei

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Experimental Info

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

Keywords - Diseaseⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ