Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ski-like protein

Gene

Skil

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May have regulatory role in cell division or differentiation in response to extracellular signals.By similarity

GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-MMU-2173795 Downregulation of SMAD2/3:SMAD4 transcriptional activity

Names & Taxonomyi

Protein namesi
Recommended name:
Ski-like protein
Alternative name(s):
Ski-related oncogene
Ski-related protein
Gene namesi
Name:Skil
Synonyms:Skir, Sno
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 3

Organism-specific databases

MGIiMGI:106203 Skil

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001293881 – 675Ski-like proteinAdd BLAST675

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Cross-linki47Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki67Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei449PhosphoserineBy similarity1
Cross-linki486Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki518Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity

Post-translational modificationi

Ubiquitinated by RNF111 and RNF165, promoting proteasomal degradation, leading to enhance the BMP-Smad signaling.1 Publication

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiQ60665
PRIDEiQ60665

PTM databases

iPTMnetiQ60665
PhosphoSitePlusiQ60665

Expressioni

Gene expression databases

BgeeiENSMUSG00000027660 Expressed in 307 organ(s), highest expression level in pineal body
CleanExiMM_SKIL
ExpressionAtlasiQ60665 baseline and differential
GenevisibleiQ60665 MM

Interactioni

Subunit structurei

Interacts with CPNE4 (via VWFA domain) (PubMed:12522145). Interacts with SMAD2, SMAD3 and RNF111. Interacts with WWP1 (By similarity).By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi203269, 8 interactors
STRINGi10090.ENSMUSP00000029194

Structurei

3D structure databases

ProteinModelPortaliQ60665
SMRiQ60665
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili526 – 669Sequence analysisAdd BLAST144

Sequence similaritiesi

Belongs to the SKI family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IFDK Eukaryota
ENOG410Y8AU LUCA
GeneTreeiENSGT00530000063040
HOGENOMiHOG000039989
HOVERGENiHBG006599
InParanoidiQ60665
KOiK18499
OMAiKPESTTC
OrthoDBiEOG091G0O02
PhylomeDBiQ60665
TreeFamiTF324133

Family and domain databases

Gene3Di3.10.260.20, 1 hit
3.10.390.10, 1 hit
InterProiView protein in InterPro
IPR014890 c-SKI_SMAD4-bd_dom
IPR009061 DNA-bd_dom_put_sf
IPR010919 SAND-like_dom_sf
IPR028373 Ski-rel_Sno
IPR003380 SKI/SNO/DAC
IPR037000 Ski_DNA-bd_sf
IPR023216 Tscrpt_reg_SKI_SnoN
PANTHERiPTHR10005 PTHR10005, 1 hit
PTHR10005:SF3 PTHR10005:SF3, 1 hit
PfamiView protein in Pfam
PF08782 c-SKI_SMAD_bind, 1 hit
PF02437 Ski_Sno, 1 hit
SMARTiView protein in SMART
SM01046 c-SKI_SMAD_bind, 1 hit
SUPFAMiSSF46955 SSF46955, 1 hit
SSF63763 SSF63763, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q60665-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MENLQSKFSL VQGSNKKLNG MEDDGSPPVK KMMTDIHANG KTLTKVKKEH
60 70 80 90 100
LDDYGDASVE PDGEHAKRNR VSLPETLNLN PSLKHTLAQF HLSSQSSLGG
110 120 130 140 150
PAAFSARYSQ ESMSPTVFLP LPSPQVLPGP LLIPSDSSTE LTQTLLEGES
160 170 180 190 200
ISCFQVGGEK RLCLPQVLNS VLREFSLQQI NTVCDELYIY CSRCTSDQLH
210 220 230 240 250
ILKVLGILPF NAPSCGLITL TDAQRLCNAL LRPRTFPQNG SILPAKSSLA
260 270 280 290 300
QLKETGSAFE VEHECLGKCQ GLFAPQFYVQ PDAPCIQCLE CCGMFAPQTF
310 320 330 340 350
VMHSHRSPDK RTCHWGFESA KWHCYLHVNQ KYLGTPEEKK LKIILEEMKE
360 370 380 390 400
KFSMRNGKRI QSKTDTPSGM ELPSWYPVIK QEGDHVPQTH SFLHPSYYLY
410 420 430 440 450
MCDKVVAPNV SLTSAASQSK EATKAETSKS TSKQSEKPHE SSQHQKTVSY
460 470 480 490 500
PDVSLEEQEK MDLKTSRELY SCLDSSISNN STSRKKSESA VCSLVRGTSK
510 520 530 540 550
RDSEDSSPLL VRDGEDDKGK IMEDVMRTYV RQQEKLNSIL QRKQQLQMEV
560 570 580 590 600
EMLSSSKAMK ELTEEQQNLQ KELESLQSEH AQRMEEFYIE QRDLEKKLEQ
610 620 630 640 650
VMQQKCTCDS TLEKDREAEY AAQLAELRQR LDHAEADRQE LQDELRQERE
660 670
ARQKLEMMIK ELKLQIGKSS KPSKD
Length:675
Mass (Da):76,359
Last modified:June 21, 2005 - v2
Checksum:iCE17BBC167693869
GO
Isoform 2 (identifier: Q60665-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     428-474: SKSTSKQSEKPHESSQHQKTVSYPDVSLEEQEKMDLKTSRELYSCLD → N

Show »
Length:629
Mass (Da):71,061
Checksum:iC58CCA2D5403F39E
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3Z7C5D3Z7C5_MOUSE
Ski-like protein
Skil
549Annotation score:
D3YYG2D3YYG2_MOUSE
Ski-like protein
Skil
187Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti63 – 66GEHA → RAR in AAB65849 (PubMed:9207045).Curated4
Sequence conflicti130P → T in AAB65849 (PubMed:9207045).Curated1
Sequence conflicti150S → T in AAB65849 (PubMed:9207045).Curated1
Sequence conflicti205L → S in AAB65849 (PubMed:9207045).Curated1
Sequence conflicti229A → T in AAB65849 (PubMed:9207045).Curated1
Sequence conflicti302 – 303MH → ID in AAB50266 (PubMed:8834472).Curated2
Sequence conflicti302 – 303MH → ID in AAB50267 (PubMed:8834472).Curated2
Sequence conflicti542R → G in AAB50266 (PubMed:8834472).Curated1
Sequence conflicti542R → G in AAB50267 (PubMed:8834472).Curated1
Sequence conflicti618A → P in AAB50266 (PubMed:8834472).Curated1
Sequence conflicti618A → P in AAB50267 (PubMed:8834472).Curated1
Sequence conflicti622A → G in AAB65849 (PubMed:9207045).Curated1
Sequence conflicti638 – 639RQ → QR in AAB65849 (PubMed:9207045).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_014265428 – 474SKSTS…YSCLD → N in isoform 2. 3 PublicationsAdd BLAST47

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U10530 mRNA Translation: AAB50266.1
U10532 mRNA Translation: AAB50267.1
U14655 mRNA Translation: AAB65849.1
BC049934 mRNA Translation: AAH49934.1
CCDSiCCDS38408.1 [Q60665-1]
CCDS50886.1 [Q60665-2]
RefSeqiNP_001034179.1, NM_001039090.2 [Q60665-2]
NP_035516.2, NM_011386.3 [Q60665-1]
XP_006535490.1, XM_006535427.3 [Q60665-1]
UniGeneiMm.15406
Mm.491655

Genome annotation databases

EnsembliENSMUST00000029194; ENSMUSP00000029194; ENSMUSG00000027660 [Q60665-1]
ENSMUST00000118204; ENSMUSP00000112413; ENSMUSG00000027660 [Q60665-1]
ENSMUST00000118470; ENSMUSP00000113256; ENSMUSG00000027660 [Q60665-2]
GeneIDi20482
KEGGimmu:20482
UCSCiuc008ovv.2 mouse [Q60665-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U10530 mRNA Translation: AAB50266.1
U10532 mRNA Translation: AAB50267.1
U14655 mRNA Translation: AAB65849.1
BC049934 mRNA Translation: AAH49934.1
CCDSiCCDS38408.1 [Q60665-1]
CCDS50886.1 [Q60665-2]
RefSeqiNP_001034179.1, NM_001039090.2 [Q60665-2]
NP_035516.2, NM_011386.3 [Q60665-1]
XP_006535490.1, XM_006535427.3 [Q60665-1]
UniGeneiMm.15406
Mm.491655

3D structure databases

ProteinModelPortaliQ60665
SMRiQ60665
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi203269, 8 interactors
STRINGi10090.ENSMUSP00000029194

PTM databases

iPTMnetiQ60665
PhosphoSitePlusiQ60665

Proteomic databases

PaxDbiQ60665
PRIDEiQ60665

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000029194; ENSMUSP00000029194; ENSMUSG00000027660 [Q60665-1]
ENSMUST00000118204; ENSMUSP00000112413; ENSMUSG00000027660 [Q60665-1]
ENSMUST00000118470; ENSMUSP00000113256; ENSMUSG00000027660 [Q60665-2]
GeneIDi20482
KEGGimmu:20482
UCSCiuc008ovv.2 mouse [Q60665-1]

Organism-specific databases

CTDi6498
MGIiMGI:106203 Skil

Phylogenomic databases

eggNOGiENOG410IFDK Eukaryota
ENOG410Y8AU LUCA
GeneTreeiENSGT00530000063040
HOGENOMiHOG000039989
HOVERGENiHBG006599
InParanoidiQ60665
KOiK18499
OMAiKPESTTC
OrthoDBiEOG091G0O02
PhylomeDBiQ60665
TreeFamiTF324133

Enzyme and pathway databases

ReactomeiR-MMU-2173795 Downregulation of SMAD2/3:SMAD4 transcriptional activity

Miscellaneous databases

ChiTaRSiSkil mouse
PROiPR:Q60665
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000027660 Expressed in 307 organ(s), highest expression level in pineal body
CleanExiMM_SKIL
ExpressionAtlasiQ60665 baseline and differential
GenevisibleiQ60665 MM

Family and domain databases

Gene3Di3.10.260.20, 1 hit
3.10.390.10, 1 hit
InterProiView protein in InterPro
IPR014890 c-SKI_SMAD4-bd_dom
IPR009061 DNA-bd_dom_put_sf
IPR010919 SAND-like_dom_sf
IPR028373 Ski-rel_Sno
IPR003380 SKI/SNO/DAC
IPR037000 Ski_DNA-bd_sf
IPR023216 Tscrpt_reg_SKI_SnoN
PANTHERiPTHR10005 PTHR10005, 1 hit
PTHR10005:SF3 PTHR10005:SF3, 1 hit
PfamiView protein in Pfam
PF08782 c-SKI_SMAD_bind, 1 hit
PF02437 Ski_Sno, 1 hit
SMARTiView protein in SMART
SM01046 c-SKI_SMAD_bind, 1 hit
SUPFAMiSSF46955 SSF46955, 1 hit
SSF63763 SSF63763, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSKIL_MOUSE
AccessioniPrimary (citable) accession number: Q60665
Secondary accession number(s): Q60702, Q78E90, Q80VK5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: June 21, 2005
Last modified: November 7, 2018
This is version 146 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again