Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Bile acid receptor

Gene

Nr1h4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Ligand-activated transcription factor. Receptor for bile acids (BAs) such as chenodeoxycholic acid (CDCA), lithocholic acid, deoxycholic acid (DCA) and allocholic acid (ACA). Plays a essential role in BA homeostasis through the regulation of genes involved in BA synthesis, conjugation and enterohepatic circulation. Also regulates lipid and glucose homeostasis and is involved in innate immune response (PubMed:11030617, PubMed:21383957, PubMed:22820415). The FXR-RXR heterodimer binds predominantly to farnesoid X receptor response elements (FXREs) containing two inverted repeats of the consensus sequence 5'-AGGTCA-3' in which the monomers are spaced by 1 nucleotide (IR-1) but also to tandem repeat DR1 sites with lower affinity, and can be activated by either FXR or RXR-specific ligands. It is proposed that monomeric nuclear receptors such as NR5A2/LRH-1 bound to coregulatory nuclear responsive element (NRE) halfsites located in close proximity to FXREs modulate transcriptional activity (PubMed:20091679, PubMed:20483916). In the liver activates transcription of the corepressor NR0B2 thereby indirectly inhibiting CYP7A1 and CYP8B1 (involved in BA synthesis) implicating at least in part histone demethylase KDM1A resulting in epigenomic repression, and SLC10A1/NTCP (involved in hepatic uptake of conjugated BAs). Activates transcription of the repressor MAFG (involved in regulation of BA synthesis) (PubMed:21383957, PubMed:25651182, PubMed:25545350). Activates transcription of SLC27A5/BACS and BAAT (involved in BA conjugation), ABCB11/BSEP (involved in bile salt export) by directly recruiting histone methyltransferase CARM1, and ABCC2/MRP2 (involved in secretion of conjugated BAs) and ABCB4 (involved in secretion of phosphatidylcholine in the small intestine) (PubMed:21383957). In ileal enterocytes activates FABP6/IBABP (involved in cytosolic transport), SLC51A/OSTA and SLC51B/OSTB (involved in secretion of conjugated BAs to the portal blood), and repressor NR0B2/SHP thereby indirectly inhibiting SLC10A2/ASBT (involved in BA uptake) (By similarity). In the intestine activates FGF15 expression and secretion leading to hepatic CYP7A1 repression; the function also involves the coordinated induction of hepatic KLB/beta-klotho expression (PubMed:16213224, PubMed:26505219). Transcriptional activation of FABP6/IBAP and SCD1 but not of ABCB11 is isoform-specific (PubMed:12393883). Regulates transcription of liver UGT2B4 and SULT2A1 involved in BA detoxification; binding to the UGT2B4 promoter seems to imply a monomeric transactivation independent of RXRA (By similarity). Modulates lipid homeostasis by activating liver NR0B2/SHP-mediated repression of SREBF1 isoform SREBP-1C (involved in de novo lipogenesis), expression of PLTP (involved in HDL formation), SCARB1 (involved in HDL hepatic uptake), APOE, APOC1, APOC4, VLDLR and SDC1 (involved in the hepatic uptake of LDL and IDL remnants), and inhibiting expression of MTTP (involved in VLDL assembly) (PubMed:12421815, PubMed:15146238). Increases expression of APOC2 (promoting lipoprotein lipase activity implicated in triglyceride clearance) (PubMed:11579204). Transrepresses APOA1 probably involving a monomeric competition with NR2A1 for binding to a DR1 element (PubMed:21804189). Also reduces triglyceride clearance by inhibiting expression of ANGPTL3 and APOC3 (both involved in inhibition of lipoprotein lipase) (PubMed:12891557, PubMed:15146238). Involved in glucose homeostasis by modulating hepatic gluconeogenesis through activation of NR0B2/SHP-mediated repression of respective genes. Modulates glycogen synthesis (inducing phosphorylation of glycogen synthase kinase-3). Modulates glucose-stimulated insulin secretion and is involved in insulin resistance (PubMed:15564327, PubMed:16446356, PubMed:16557297, PubMed:16410358, PubMed:20447400). Involved in intestinal innate immunity. Plays a role in protecting the distal small intestine against bacterial overgrowth and preservation of the epithelial barrier (PubMed:16473946, PubMed:21242261). Down-regulates inflammatory cytokine expression in several types of immune cells including macrophages and mononuclear cells (PubMed:19864602). Mediates transrepression of TLR4-induced cytokine expression; the function seems to require its sumoylation and prevents N-CoR nuclear receptor corepressor clearance from target genes such as IL1B and NOS2 (By similarity). Involved in the TLR9-mediated protective mechanism in intestinal inflammation (PubMed:23372731). Plays a anti-inflammatory role in liver inflammation; proposed to inhibit proinflammatory (but not antiapoptotic) NF-kappa-B signaling (PubMed:18972444).By similarity2 Publications27 Publications
Isoform 2: Activates transcription of IBAP and SDC1.1 Publication
Isoform 4: Activates transcription of IBAP and SDC1.1 Publication

Miscellaneous

Mouse Nr1h4/FXR is less responsive to CDCA and more responsive to cholic acid (CA) than human FXR.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei377AgonistBy similarity1
Binding sitei385AgonistBy similarity1
Binding sitei463AgonistBy similarity1
Binding sitei485AgonistBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi135 – 210Nuclear receptorPROSITE-ProRule annotationAdd BLAST76
Zinc fingeri138 – 158NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri174 – 198NR C4-typePROSITE-ProRule annotationAdd BLAST25

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActivator, DNA-binding, Receptor, Repressor
Biological processImmunity, Inflammatory response, Innate immunity, Transcription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-MMU-159418 Recycling of bile acids and salts
R-MMU-192105 Synthesis of bile acids and bile salts
R-MMU-193368 Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol
R-MMU-193807 Synthesis of bile acids and bile salts via 27-hydroxycholesterol
R-MMU-211976 Endogenous sterols
R-MMU-383280 Nuclear Receptor transcription pathway
R-MMU-4090294 SUMOylation of intracellular receptors

Names & Taxonomyi

Protein namesi
Recommended name:
Bile acid receptor
Alternative name(s):
Farnesoid X-activated receptor
Farnesol receptor HRR-1
Nuclear receptor subfamily 1 group H member 4
Retinoid X receptor-interacting protein 14
Short name:
RXR-interacting protein 14
Gene namesi
Name:Nr1h4
Synonyms:Bar, Fxr, Rip14
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 10

Organism-specific databases

MGIiMGI:1352464 Nr1h4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Involvement in diseasei

Activation protects mice against cholestasis, development of chronical intestinal inflammation and fibrosis. May suppress intestinal tumorigenesis.3 Publications

Disruption phenotypei

Elevated serum bile acid, cholesterol, and triglycerides, increased hepatic cholesterol and triglycerides, and a proatherogenic serum lipoprotein profile. Reduced bile acid pools and reduced fecal bile acid excretion.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi370K → N: Increases affinity to CDCA and transcriptional activity in response to CDCA; when associated with I-388. 1 Publication1
Mutagenesisi388V → I: Increases affinity to CDCA and transcriptional activity in response to CDCA; when associated with N-370. 1 Publication1

Keywords - Diseasei

Tumor suppressor

Chemistry databases

ChEMBLiCHEMBL5343

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000535391 – 488Bile acid receptorAdd BLAST488

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Cross-linki133Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)By similarity
Modified residuei146Phosphoserine; by PKC/PRKCABy similarity1
Modified residuei165Phosphoserine; by PKC/PRKCABy similarity1
Modified residuei168N6-acetyllysine; by EP300By similarity1
Modified residuei221N6-methyllysine; by SETD7By similarity1
Modified residuei228N6-acetyllysine; by EP300By similarity1
Cross-linki291Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)By similarity
Modified residuei458Phosphothreonine; by PKC/PRKCZBy similarity1

Post-translational modificationi

Acetylated by EP300 (PubMed:18842595). Lys-228 as is the major acetylation site for EP300; the dynamicly regulated acetylation inhibits heterodimerization with RXRA and transactivation activity. Deacetylated by SIRT1 (By similarity). Elevated acetylation levels are found in metabolic disease states (mouse models of obesity and type II diabetes) (PubMed:19883617).By similarity2 Publications
Methylation may increase transactivation of target genes.By similarity
Phosphorylation by PKC/PRKCA increases transactivation activity by promoting association with PPARGC1A.By similarity
Sumoylated upon ligand binding.By similarity

Keywords - PTMi

Acetylation, Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiQ60641
PRIDEiQ60641

PTM databases

iPTMnetiQ60641
PhosphoSitePlusiQ60641

Expressioni

Tissue specificityi

Expressed in liver and kidney. Expressed in pancreatic beta cells and macrophages. Expressed in the villus epithelium in adult ileum, with highest expression in the intervillus regions. Expression in colon is reduced by inflammation.4 Publications

Gene expression databases

BgeeiENSMUSG00000047638 Expressed in 110 organ(s), highest expression level in epithelium of small intestine
CleanExiMM_NR1H4
ExpressionAtlasiQ60641 baseline and differential
GenevisibleiQ60641 MM

Interactioni

Subunit structurei

Binds DNA predominantly as a heterodimer with RXRA (PubMed:7760852). After activation by agonist binding interacts with coactivators. Interacts with PPARGC1A, SMARCA4 and EP300 (PubMed:14729567, PubMed:18842595, PubMed:19805516). Interacts with NCOA1, NCOA2, CARM1, SETD7, PRMT1, GPS2, SMARCA4 and MED1. Interacts with XRCC5 and XRCC6; decreasing NR1H4/FXR transactivation activity towards ABCB11/BSEP. Interacts with PAGR1 AND NCOA6; indicative for an association with an MLL2/MLL3 complex (ASCOM) (By similarity). Interacts with NR5A2 (PubMed:20483916).By similarity5 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Ppargc1aO70343-13EBI-11659377,EBI-11359934

GO - Molecular functioni

Protein-protein interaction databases

BioGridi203043, 7 interactors
DIPiDIP-443N
IntActiQ60641, 1 interactor
STRINGi10090.ENSMUSP00000100933

Chemistry databases

BindingDBiQ60641

Structurei

3D structure databases

ProteinModelPortaliQ60641
SMRiQ60641
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini264 – 488NR LBDPROSITE-ProRule annotationAdd BLAST225

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni344 – 352Agonist bindingBy similarity9

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri138 – 158NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri174 – 198NR C4-typePROSITE-ProRule annotationAdd BLAST25

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG3575 Eukaryota
ENOG410XRZC LUCA
GeneTreeiENSGT00870000136372
HOGENOMiHOG000220843
HOVERGENiHBG108655
InParanoidiQ60641
KOiK08537
OMAiMPQEITN
OrthoDBiEOG091G0I4P
TreeFamiTF316304

Family and domain databases

Gene3Di3.30.50.10, 1 hit
InterProiView protein in InterPro
IPR035500 NHR_like_dom_sf
IPR000536 Nucl_hrmn_rcpt_lig-bd
IPR001723 Nuclear_hrmn_rcpt
IPR001728 ThyrH_rcpt
IPR001628 Znf_hrmn_rcpt
IPR013088 Znf_NHR/GATA
PfamiView protein in Pfam
PF00104 Hormone_recep, 1 hit
PF00105 zf-C4, 1 hit
PRINTSiPR00398 STRDHORMONER
PR00047 STROIDFINGER
PR00546 THYROIDHORMR
SMARTiView protein in SMART
SM00430 HOLI, 1 hit
SM00399 ZnF_C4, 1 hit
SUPFAMiSSF48508 SSF48508, 1 hit
PROSITEiView protein in PROSITE
PS51843 NR_LBD, 1 hit
PS00031 NUCLEAR_REC_DBD_1, 1 hit
PS51030 NUCLEAR_REC_DBD_2, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q60641-1) [UniParc]FASTAAdd to basket
Also known as: FXRbeta1, FXRalpha3, FXRalpha2(+)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVMQFQGLEN PIQISLHHSH RLSGFVPEGM SVKPAKGMLT EHAAGPLGQN
60 70 80 90 100
LDLESYSPYN NVPFPQVQPQ ISSSSYYSNL GFYPQQPEDW YSPGIYELRR
110 120 130 140 150
MPAETGYQGE TEVSEMPVTK KPRMAAASAG RIKGDELCVV CGDRASGYHY
160 170 180 190 200
NALTCEGCKG FFRRSITKNA VYKCKNGGNC VMDMYMRRKC QECRLRKCKE
210 220 230 240 250
MGMLAECMYT GLLTEIQCKS KRLRKNVKQH ADQTANEDDS EGRDLRQVTS
260 270 280 290 300
TTKFCREKTE LTADQQTLLD YIMDSYNKQR MPQEITNKIL KEEFSAEENF
310 320 330 340 350
LILTEMATSH VQILVEFTKK LPGFQTLDHE DQIALLKGSA VEAMFLRSAE
360 370 380 390 400
IFNKKLPAGH ADLLEERIRK SGISDEYITP MFSFYKSVGE LKMTQEEYAL
410 420 430 440 450
LTAIVILSPD RQYIKDREAV EKLQEPLLDV LQKLCKMYQP ENPQHFACLL
460 470 480
GRLTELRTFN HHHAEMLMSW RVNDHKFTPL LCEIWDVQ
Note: Produced by alternative promoter usage.
Length:488
Mass (Da):55,994
Last modified:July 27, 2011 - v3
Checksum:i3E59B7146F8ECC86
GO
Isoform 2 (identifier: Q60641-2) [UniParc]FASTAAdd to basket
Also known as: FXRbeta2, FXFRalpha4, FXRalpha2(-)

The sequence of this isoform differs from the canonical sequence as follows:
     208-211: Missing.

Note: Produced by alternative splicing of isoform 1.
Show »
Length:484
Mass (Da):55,542
Checksum:i06B56494305A438A
GO
Isoform 3 (identifier: Q60641-3) [UniParc]FASTAAdd to basket
Also known as: FXRalpha1, FXRalpha1(+)

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MVMQFQGLENPIQISLHHSHRLSGFVPEGMSVKPAK → MNLIGHSHLQATDEFSLSESLF

Note: Produced by alternative promoter usage.
Show »
Length:474
Mass (Da):54,439
Checksum:i8629C4BAD8DC75B0
GO
Isoform 4 (identifier: Q60641-4) [UniParc]FASTAAdd to basket
Also known as: FXRalpha2, FXRalpha1(-)

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MVMQFQGLENPIQISLHHSHRLSGFVPEGMSVKPAK → MNLIGHSHLQATDEFSLSESLF
     208-211: Missing.

Note: Produced by alternative splicing of isoform 3.
Show »
Length:470
Mass (Da):53,987
Checksum:i01E7DDA2F92BD35B
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti28E → D in AAC53066 (PubMed:7760852).Curated1
Sequence conflicti28E → D in AAH15261 (PubMed:15489334).Curated1
Sequence conflicti199K → R in AAC53065 (PubMed:7760852).Curated1
Sequence conflicti199K → R in AAC53066 (PubMed:7760852).Curated1
Sequence conflicti199K → R in AAC52978 (PubMed:7760852).Curated1
Sequence conflicti199K → R in AAH15261 (PubMed:15489334).Curated1
Sequence conflicti235A → V in AAC53065 (PubMed:7760852).Curated1
Sequence conflicti235A → V in AAC53066 (PubMed:7760852).Curated1
Sequence conflicti235A → V in AAC52978 (PubMed:7760852).Curated1
Sequence conflicti235A → V in AAH15261 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0581571 – 36MVMQF…VKPAK → MNLIGHSHLQATDEFSLSES LF in isoform 3 and isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_003666208 – 211Missing in isoform 2 and isoform 4. 3 Publications4

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U09416 mRNA Translation: AAC53066.1
U09417 mRNA Translation: AAC53065.1
U09418 mRNA Translation: AAC52978.1
AC152417 Genomic DNA No translation available.
BC015261 mRNA Translation: AAH15261.1
CCDSiCCDS24116.1 [Q60641-2]
CCDS48668.1 [Q60641-1]
CCDS48669.1 [Q60641-3]
PIRiI49018
I49019
I49020
RefSeqiNP_001156976.1, NM_001163504.1 [Q60641-3]
NP_001157172.1, NM_001163700.1 [Q60641-1]
XP_006513454.1, XM_006513391.3 [Q60641-3]
XP_006513456.1, XM_006513393.3 [Q60641-4]
UniGeneiMm.3095

Genome annotation databases

EnsembliENSMUST00000058126; ENSMUSP00000053092; ENSMUSG00000047638 [Q60641-2]
ENSMUST00000105296; ENSMUSP00000100933; ENSMUSG00000047638 [Q60641-1]
ENSMUST00000105297; ENSMUSP00000100934; ENSMUSG00000047638 [Q60641-3]
GeneIDi20186
KEGGimmu:20186
UCSCiuc007gsg.2 mouse [Q60641-1]
uc007gsh.2 mouse

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U09416 mRNA Translation: AAC53066.1
U09417 mRNA Translation: AAC53065.1
U09418 mRNA Translation: AAC52978.1
AC152417 Genomic DNA No translation available.
BC015261 mRNA Translation: AAH15261.1
CCDSiCCDS24116.1 [Q60641-2]
CCDS48668.1 [Q60641-1]
CCDS48669.1 [Q60641-3]
PIRiI49018
I49019
I49020
RefSeqiNP_001156976.1, NM_001163504.1 [Q60641-3]
NP_001157172.1, NM_001163700.1 [Q60641-1]
XP_006513454.1, XM_006513391.3 [Q60641-3]
XP_006513456.1, XM_006513393.3 [Q60641-4]
UniGeneiMm.3095

3D structure databases

ProteinModelPortaliQ60641
SMRiQ60641
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi203043, 7 interactors
DIPiDIP-443N
IntActiQ60641, 1 interactor
STRINGi10090.ENSMUSP00000100933

Chemistry databases

BindingDBiQ60641
ChEMBLiCHEMBL5343

PTM databases

iPTMnetiQ60641
PhosphoSitePlusiQ60641

Proteomic databases

PaxDbiQ60641
PRIDEiQ60641

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000058126; ENSMUSP00000053092; ENSMUSG00000047638 [Q60641-2]
ENSMUST00000105296; ENSMUSP00000100933; ENSMUSG00000047638 [Q60641-1]
ENSMUST00000105297; ENSMUSP00000100934; ENSMUSG00000047638 [Q60641-3]
GeneIDi20186
KEGGimmu:20186
UCSCiuc007gsg.2 mouse [Q60641-1]
uc007gsh.2 mouse

Organism-specific databases

CTDi9971
MGIiMGI:1352464 Nr1h4

Phylogenomic databases

eggNOGiKOG3575 Eukaryota
ENOG410XRZC LUCA
GeneTreeiENSGT00870000136372
HOGENOMiHOG000220843
HOVERGENiHBG108655
InParanoidiQ60641
KOiK08537
OMAiMPQEITN
OrthoDBiEOG091G0I4P
TreeFamiTF316304

Enzyme and pathway databases

ReactomeiR-MMU-159418 Recycling of bile acids and salts
R-MMU-192105 Synthesis of bile acids and bile salts
R-MMU-193368 Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol
R-MMU-193807 Synthesis of bile acids and bile salts via 27-hydroxycholesterol
R-MMU-211976 Endogenous sterols
R-MMU-383280 Nuclear Receptor transcription pathway
R-MMU-4090294 SUMOylation of intracellular receptors

Miscellaneous databases

PROiPR:Q60641
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000047638 Expressed in 110 organ(s), highest expression level in epithelium of small intestine
CleanExiMM_NR1H4
ExpressionAtlasiQ60641 baseline and differential
GenevisibleiQ60641 MM

Family and domain databases

Gene3Di3.30.50.10, 1 hit
InterProiView protein in InterPro
IPR035500 NHR_like_dom_sf
IPR000536 Nucl_hrmn_rcpt_lig-bd
IPR001723 Nuclear_hrmn_rcpt
IPR001728 ThyrH_rcpt
IPR001628 Znf_hrmn_rcpt
IPR013088 Znf_NHR/GATA
PfamiView protein in Pfam
PF00104 Hormone_recep, 1 hit
PF00105 zf-C4, 1 hit
PRINTSiPR00398 STRDHORMONER
PR00047 STROIDFINGER
PR00546 THYROIDHORMR
SMARTiView protein in SMART
SM00430 HOLI, 1 hit
SM00399 ZnF_C4, 1 hit
SUPFAMiSSF48508 SSF48508, 1 hit
PROSITEiView protein in PROSITE
PS51843 NR_LBD, 1 hit
PS00031 NUCLEAR_REC_DBD_1, 1 hit
PS51030 NUCLEAR_REC_DBD_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiNR1H4_MOUSE
AccessioniPrimary (citable) accession number: Q60641
Secondary accession number(s): D3YTT2
, E9QJW2, Q60642, Q60643
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 27, 2002
Last sequence update: July 27, 2011
Last modified: September 12, 2018
This is version 176 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again