Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q60636 (PRDM1_MOUSE)

Entry version 169 (22 Apr 2020)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

PR domain zinc finger protein 1

Gene

Prdm1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcription factor that mediates a transcriptional program in various innate and adaptive immune tissue-resident lymphocyte T cell types such as tissue-resident memory T (Trm), natural killer (trNK) and natural killer T (NKT) cells and negatively regulates gene expression of proteins that promote the egress of tissue-resident T-cell populations from non-lymphoid organs (PubMed:27102484). Plays a role in the development, retention and long-term establishment of adaptive and innate tissue-resident lymphocyte T cell types in non-lymphoid organs, such as the skin and gut, but also in other nonbarrier tissues like liver and kidney, and therefore may provide immediate immunological protection against reactivating infections or viral reinfection (PubMed:27102484). Binds specifically to the PRDI element in the promoter of the beta-interferon gene (By similarity). Drives the maturation of B-lymphocytes into Ig secreting cells (By similarity). Associates with the transcriptional repressor ZNF683 to chromatin at gene promoter regions (PubMed:27102484).By similarity1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri606 – 628C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri634 – 656C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri662 – 684C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri690 – 712C2H2-type 4PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, DNA-binding, Methyltransferase, Repressor, Transferase
Biological processAdaptive immunity, Immunity, Innate immunity, Transcription, Transcription regulation
LigandMetal-binding, S-adenosyl-L-methionine, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
PR domain zinc finger protein 1 (EC:2.1.1.-)
Alternative name(s):
B lymphocyte-induced maturation protein 1
Short name:
Blimp-1
Beta-interferon gene positive regulatory domain I-binding factor
PR domain-containing protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Prdm1
Synonyms:Blimp1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:99655 Prdm1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Early embryonic lethality (PubMed:19737919). Compound heterozygotes display germ cell defects and a rudimentary or missing fifth digit of the forelimb (PubMed:19737919). Conditional knockout in lymphocyte T cells show a weak reduction in tissue-resident memory T (Trm) cell population maintenance in the skin, gut, liver and kidney but not of splenic T cells (PubMed:27102484). Double knockouts for PRDM1/BLIMP1 and ZNF683 result in a strong inhibition of Trm cell population maintenance but not of circulating memory cells (PubMed:27102484). Display an enhancement of natural killer T (NKT) cells migration preferentially to the white pulp of the spleen in response to chemotactic stimuli (PubMed:27102484).2 Publications

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000477581 – 856PR domain zinc finger protein 1Add BLAST856

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki847Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternateBy similarity
Cross-linki847Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateBy similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Sumoylation at Lys-847 by PIAS1 augments transcriptional repressor activity, and is critical for plasma cell differentiation.By similarity
Ubiquitinated by SCF(FBXO11), leading to its degradation by the proteasome.By similarity

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q60636

PeptideAtlas

More...PeptideAtlasi		Q60636

PRoteomics IDEntifications database

More...PRIDEi		Q60636

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q60636

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q60636

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in innate lymphocytes, including tissue-resident conventional natural killer (cNK) cells in liver (PubMed:27102484). Expressed also weakly in tissue-resident natural killer (trNK) and natural killer T (NKT) cells in liver (PubMed:27102484). Isoform 1 is detected in bone marrow, spleen and lymph node but not in brain, heart, kidney, liver, ovary or muscle. Weak expression detected in the lung. Isoform 3 is detected only in yolk sac. Isoform 4 is detected in embryo, yolk sac, placenta, splenocytes, and activated T-cells.4 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By lymphokines, specifically IL-2 and IL-5. Up-regulated during dendritic cell maturation.
(Microbial infection) Up-regulated in response to Herpes simplex virus (HSV) infection in skin and spleen memory CD8+ T cells.1 Publication
(Microbial infection) Up-regulated in response to Lymphocytic choriomeningitis virus (LCMV) in memory CD8+ T cells.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000038151 Expressed in testis and 204 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q60636 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PRMT5 (PubMed:16699504).

Interacts with FBXO10 (By similarity).

Interacts with FBXO11 (By similarity).

By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		198355, 9 interactors

Protein interaction database and analysis system

More...IntActi		Q60636, 1 interactor

Molecular INTeraction database

More...MINTi		Q60636

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000101129

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q60636 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q60636

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini115 – 233SETPROSITE-ProRule annotationAdd BLAST119

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni558 – 605Interaction with PIAS1By similarityAdd BLAST48

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi351 – 394Glu/Pro/Ser/Thr-richAdd BLAST44

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the class V-like SAM-binding methyltransferase superfamily.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri606 – 628C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri634 – 656C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri662 – 684C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri690 – 712C2H2-type 4PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2461 Eukaryota
ENOG410ZFVU LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000154798

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_007033_2_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q60636

Identification of Orthologs from Complete Genome Data

More...OMAi		NFNLFPR

Database of Orthologous Groups

More...OrthoDBi		1318335at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q60636

TreeFam database of animal gene trees

More...TreeFami		TF316545

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001214 SET_dom
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00856 SET, 1 hit
PF00096 zf-C2H2, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00317 SET, 1 hit
SM00355 ZnF_C2H2, 5 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF57667 SSF57667, 3 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50280 SET, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 4 hits
PS50157 ZINC_FINGER_C2H2_2, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q60636-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MREAYLRCWI FSWKNVWVRP CQRLHFKTVL LQGSLLYTAL DSYSTVQAAP 
        60         70         80         90        100
KSSSGSVKFQ GLAETGIMKM DMEDADMTLW TEAEFEEKCT YIVNDHPWDS 
       110        120        130        140        150
GADGGTSVQA EASLPRNLLF KYAANNSKEV IGVVSKEYIP KGTRFGPLIG 
       160        170        180        190        200
EVYTNDTVPK NANRKYFWRI YSREEFHHFI DGFNEEKSNW MRYVNPAHSA 
       210        220        230        240        250
REQNLAACQN GMNIYFYTIK PIPANQELLV WYCRDFAERL HYPYPGELTV 
       260        270        280        290        300
INLTQTESNP KQYSSEKNEL YPKSVPKREY SVKEILKLDS NPSKRKDIYR 
       310        320        330        340        350
SNISPFTLEK DMDGFRKNGS PDMPFYPRVV YPIRAPLPED FLKASLAYGM 
       360        370        380        390        400
ERPTYITHSP LPSSTTPSPP ASSSPEQSLK SSSPHSSPGN TVSPLAPGLP 
       410        420        430        440        450
EHRDSYSYLN VSYGSEGLGS YPGYAPAPHL PPAFIPSYNA HYPKFLLPPY 
       460        470        480        490        500
GISSNGLSTM NNINGINNFS LFPRLYPVYS NLLSGSSLPH PMLNPASLPS 
       510        520        530        540        550
SLPTDGARRL LPPEHPKEVL IPAPHSAFSL TGAAASMKDE SSPPSGSPTA 
       560        570        580        590        600
GTAATSEHVV QPKATSSVMA APSTDGAMNL IKNKRNMTGY KTLPYPLKKQ 
       610        620        630        640        650
NGKIKYECNV CAKTFGQLSN LKVHLRVHSG ERPFKCQTCN KGFTQLAHLQ 
       660        670        680        690        700
KHYLVHTGEK PHECQVCHKR FSSTSNLKTH LRLHSGEKPY QCKVCPAKFT 
       710        720        730        740        750
QFVHLKLHKR LHTRERPHKC AQCHKSYIHL CSLKVHLKGN CPAGPAAGLP 
       760        770        780        790        800
LEDLTRINEE IERFDISDNA DRLEDMEDSV DVTSMVEKEI LAVVRKEKEE 
       810        820        830        840        850
TSLKVSLQRN MGNGLLSSGC SLYESSDLSL MKLPHSNPLP LVPVKVKQET 

VEPMDP
Note: Produced by alternative splicing.
Length:856
Mass (Da):95,836
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB9AC6FC2E29ECF4A
GO
Isoform 2 (identifier: Q60636-2) [UniParc]FASTAAdd to basket
Also known as: 1A

The sequence of this isoform differs from the canonical sequence as follows:
     1-47: MREAYLRCWIFSWKNVWVRPCQRLHFKTVLLQGSLLYTALDSYSTVQ → MLDLLLEKRVGTTL

Note: Produced by alternative splicing of isoform 1.Curated
Show »
Length:823
Mass (Da):91,729
Checksum:i8B5904D42DDB2193
GO
Isoform 3 (identifier: Q60636-3) [UniParc]FASTAAdd to basket
Also known as: 1B

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: Missing.

Note: Produced by alternative promoter usage of isoform 2.Curated
Show »
Length:789
Mass (Da):88,228
Checksum:iD9C1AAA129A608C4
GO
Isoform 4 (identifier: Q60636-4) [UniParc]FASTAAdd to basket
Also known as: 1C

The sequence of this isoform differs from the canonical sequence as follows:
     1-47: MREAYLRCWI...TALDSYSTVQ → MTPGVPGHRTQQRPQHISALSDKAKDCSK

Note: Produced by alternative promoter usage of isoform 2.Curated
Show »
Length:838
Mass (Da):93,302
Checksum:iEF258AECEFFB6B1A
GO
Isoform 5 (identifier: Q60636-5) [UniParc]FASTAAdd to basket
Also known as: delta exon 7

The sequence of this isoform differs from the canonical sequence as follows:
     624-666: Missing.

Note: Produced by alternative splicing of isoform 1. Does not bind DNA.Curated
Show »
Length:813
Mass (Da):90,830
Checksum:iDDC40E049A8BE135
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAI29802 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti155N → K in AAI29802 (PubMed:15489334).Curated1
Sequence conflicti205L → M in AK077622 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0415701 – 67Missing in isoform 3. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_0391891 – 47MREAY…YSTVQ → MLDLLLEKRVGTTL in isoform 2. 2 PublicationsAdd BLAST47
Alternative sequenceiVSP_0415711 – 47MREAY…YSTVQ → MTPGVPGHRTQQRPQHISAL SDKAKDCSK in isoform 4. CuratedAdd BLAST47
Alternative sequenceiVSP_041572624 – 666Missing in isoform 5. CuratedAdd BLAST43

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U08185 mRNA Translation: AAA19252.1
AF305539 AF305538 Genomic DNA Translation: AAG42212.1
AK077622 mRNA No translation available.
AK149344 mRNA Translation: BAE28822.1
BC129801 mRNA Translation: AAI29802.1 Different initiation.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS23825.2 [Q60636-2]

Protein sequence database of the Protein Information Resource

More...PIRi		A53503

NCBI Reference Sequences

More...RefSeqi		NP_031574.2, NM_007548.4 [Q60636-2]
XP_006512565.1, XM_006512502.3 [Q60636-4]
XP_006512566.1, XM_006512503.2 [Q60636-3]
XP_006512568.1, XM_006512505.2 [Q60636-1]
XP_011241411.1, XM_011243109.1 [Q60636-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000039174; ENSMUSP00000039248; ENSMUSG00000038151 [Q60636-1]
ENSMUST00000105490; ENSMUSP00000101129; ENSMUSG00000038151 [Q60636-2]
ENSMUST00000218369; ENSMUSP00000151237; ENSMUSG00000038151 [Q60636-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		12142

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:12142

UCSC genome browser

More...UCSCi		uc007ezu.3 mouse [Q60636-1]
uc007ezv.3 mouse [Q60636-2]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U08185 mRNA Translation: AAA19252.1
AF305539 AF305538 Genomic DNA Translation: AAG42212.1
AK077622 mRNA No translation available.
AK149344 mRNA Translation: BAE28822.1
BC129801 mRNA Translation: AAI29802.1 Different initiation.
CCDSiCCDS23825.2 [Q60636-2]
PIRiA53503
RefSeqiNP_031574.2, NM_007548.4 [Q60636-2]
XP_006512565.1, XM_006512502.3 [Q60636-4]
XP_006512566.1, XM_006512503.2 [Q60636-3]
XP_006512568.1, XM_006512505.2 [Q60636-1]
XP_011241411.1, XM_011243109.1 [Q60636-3]

3D structure databases

SMRiQ60636
ModBaseiSearch...

Protein-protein interaction databases

BioGridi198355, 9 interactors
IntActiQ60636, 1 interactor
MINTiQ60636
STRINGi10090.ENSMUSP00000101129

PTM databases

iPTMnetiQ60636
PhosphoSitePlusiQ60636

Proteomic databases

PaxDbiQ60636
PeptideAtlasiQ60636
PRIDEiQ60636

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		19038 650 antibodies

The DNASU plasmid repository

More...DNASUi		12142

Genome annotation databases

EnsembliENSMUST00000039174; ENSMUSP00000039248; ENSMUSG00000038151 [Q60636-1]
ENSMUST00000105490; ENSMUSP00000101129; ENSMUSG00000038151 [Q60636-2]
ENSMUST00000218369; ENSMUSP00000151237; ENSMUSG00000038151 [Q60636-4]
GeneIDi12142
KEGGimmu:12142
UCSCiuc007ezu.3 mouse [Q60636-1]
uc007ezv.3 mouse [Q60636-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		639
MGIiMGI:99655 Prdm1

Phylogenomic databases

eggNOGiKOG2461 Eukaryota
ENOG410ZFVU LUCA
GeneTreeiENSGT00940000154798
HOGENOMiCLU_007033_2_1_1
InParanoidiQ60636
OMAiNFNLFPR
OrthoDBi1318335at2759
PhylomeDBiQ60636
TreeFamiTF316545

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Prdm1 mouse

Protein Ontology

More...PROi		PR:Q60636
RNActiQ60636 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000038151 Expressed in testis and 204 other tissues
GenevisibleiQ60636 MM

Family and domain databases

InterProiView protein in InterPro
IPR001214 SET_dom
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF00856 SET, 1 hit
PF00096 zf-C2H2, 2 hits
SMARTiView protein in SMART
SM00317 SET, 1 hit
SM00355 ZnF_C2H2, 5 hits
SUPFAMiSSF57667 SSF57667, 3 hits
PROSITEiView protein in PROSITE
PS50280 SET, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 4 hits
PS50157 ZINC_FINGER_C2H2_2, 4 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPRDM1_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q60636
Secondary accession number(s): A2VDE8, Q3UET9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 8, 2002
Last sequence update: November 1, 1996
Last modified: April 22, 2020
This is version 169 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again