Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kinesin-like protein KIF1B

Gene

Kif1b

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Motor for anterograde transport of mitochondria. Has a microtubule plus end-directed motility.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi97 – 104ATPPROSITE-ProRule annotation8

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionMotor protein
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-MMU-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-MMU-983189 Kinesins

Names & Taxonomyi

Protein namesi
Recommended name:
Kinesin-like protein KIF1B
Gene namesi
Name:Kif1b
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:108426 Kif1b

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Microtubule, Mitochondrion

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00001254082 – 1816Kinesin-like protein KIF1BAdd BLAST1815

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylserineBy similarity1
Modified residuei647PhosphothreonineCombined sources1
Modified residuei652PhosphothreonineCombined sources1
Modified residuei1054PhosphoserineBy similarity1
Modified residuei1057PhosphoserineBy similarity1
Modified residuei1416PhosphoserineBy similarity1
Modified residuei1454PhosphoserineCombined sources1
Modified residuei1487PhosphoserineCombined sources1
Modified residuei1573PhosphoserineBy similarity1
Modified residuei1603PhosphoserineBy similarity1
Modified residuei1610PhosphoserineBy similarity1
Modified residuei1613PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiQ60575
PeptideAtlasiQ60575
PRIDEiQ60575

PTM databases

iPTMnetiQ60575
PhosphoSitePlusiQ60575

Expressioni

Tissue specificityi

Expressed almost exclusively in adult brain tissue (mainly in the cerebellum and cerebrum) within a single type of neuronal cell.

Gene expression databases

BgeeiENSMUSG00000063077 Expressed in 309 organ(s), highest expression level in retina
CleanExiMM_KIF1B
ExpressionAtlasiQ60575 baseline and differential
GenevisibleiQ60575 MM

Interactioni

Subunit structurei

Monomer. Interacts with KBP. Interacts (via C-terminus end of the kinesin-motor domain) with CHP1; the interaction occurs in a calcium-dependent manner (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi200936, 8 interactors
IntActiQ60575, 6 interactors
STRINGi10090.ENSMUSP00000061472

Structurei

3D structure databases

ProteinModelPortaliQ60575
SMRiQ60575
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini5 – 354Kinesin motorPROSITE-ProRule annotationAdd BLAST350
Domaini556 – 612FHAPROSITE-ProRule annotationAdd BLAST57
Domaini1702 – 1799PHPROSITE-ProRule annotationAdd BLAST98

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni270 – 350Interaction with KBPBy similarityAdd BLAST81

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili365 – 386Sequence analysisAdd BLAST22
Coiled coili470 – 502Sequence analysisAdd BLAST33
Coiled coili668 – 737Sequence analysisAdd BLAST70
Coiled coili841 – 869Sequence analysisAdd BLAST29

Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family. Unc-104 subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG0245 Eukaryota
COG5059 LUCA
GeneTreeiENSGT00930000150817
HOGENOMiHOG000165968
HOVERGENiHBG052251
InParanoidiQ60575
KOiK10392
OMAiLHQEDEF
OrthoDBiEOG091G009V
PhylomeDBiQ60575
TreeFamiTF105221

Family and domain databases

CDDicd00060 FHA, 1 hit
Gene3Di2.30.29.30, 1 hit
3.40.850.10, 1 hit
InterProiView protein in InterPro
IPR000253 FHA_dom
IPR022164 Kinesin-like
IPR027640 Kinesin-like_fam
IPR022140 Kinesin-like_KIF1-typ
IPR032405 Kinesin_assoc
IPR019821 Kinesin_motor_CS
IPR001752 Kinesin_motor_dom
IPR036961 Kinesin_motor_dom_sf
IPR027417 P-loop_NTPase
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR008984 SMAD_FHA_dom_sf
PANTHERiPTHR24115 PTHR24115, 1 hit
PfamiView protein in Pfam
PF12473 DUF3694, 1 hit
PF00498 FHA, 1 hit
PF12423 KIF1B, 1 hit
PF00225 Kinesin, 1 hit
PF16183 Kinesin_assoc, 1 hit
PF00169 PH, 1 hit
PRINTSiPR00380 KINESINHEAVY
SMARTiView protein in SMART
SM00240 FHA, 1 hit
SM00129 KISc, 1 hit
SM00233 PH, 1 hit
SUPFAMiSSF49879 SSF49879, 1 hit
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50006 FHA_DOMAIN, 1 hit
PS00411 KINESIN_MOTOR_1, 1 hit
PS50067 KINESIN_MOTOR_2, 1 hit
PS50003 PH_DOMAIN, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q60575-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSGASVKVAV RVRPFNSRET SKESKCIIQM QGNSTSIINP KNPKEAPKSF
60 70 80 90 100
SFDYSYWSHT SPEDPCFASQ NRVYNDIGKE MLLHAFEGYN VCIFAYGQTG
110 120 130 140 150
AGKSYTMMGK QEESQAGIIP QLCEELFEKI NDNCNEEMSY SVEVSYMEIY
160 170 180 190 200
CERVRDLLNP KNKGNLRVRE HPLLGPYVED LSKLAVTSYT DIADLMDAGN
210 220 230 240 250
KARTVAATNM NETSSRSHAV FTIVFTQKKQ DPETNLSTEK VSKISLVDLA
260 270 280 290 300
GSERADSTGA KGTRLKEGAN INKSLTTLGK VISALAEVDN CTSKSKKKKK
310 320 330 340 350
TDFIPYRDSV LTWLLRENLG GNSRTAMVAA LSPADINYDE TLSTLRYADR
360 370 380 390 400
AKQIKCNAVI NEDPNAKLVR ELKEEVTRLK DLLRAQGLGD IIDIDPLIDD
410 420 430 440 450
YSGSGGKYLK DFQNNKHRYL LASENQRPGN FSTASMGSLT SSPSSCSLNS
460 470 480 490 500
QVGLTSVTSI QERIMSTPGG EEAIERLKES EKIIAELNET WEEKLRKTEA
510 520 530 540 550
IRMEREALLA EMGVAIREDG GTLGVFSPKK TPHLVNLNED PLMSECLLYY
560 570 580 590 600
IKDGITRVGQ ADAERRQDIV LSGAHIKEEH CLFRSERSNT GEVIVTLEPC
610 620 630 640 650
ERSETYVNGK RVAHPVQLRS GNRIIMGKNH VFRFNHPEQA RAEREKTPSA
660 670 680 690 700
ETPSEPVDWT FAQRELLEKQ GIDMKQEMEK RLQEMEILYK KEKEEADLLL
710 720 730 740 750
EQQRLDYESK LQALQRQVET RSLAAETTEE EEEEEEVPWT QHEFELAQWA
760 770 780 790 800
FRKWKSHQFT SLRDLLWGNA VYLKEANAIS VELKKKVQFQ FVLLTDTLYS
810 820 830 840 850
PVPPELLPSE MEKTHEDRPF PRTVVAVEVQ DLKNGATHYW SLDKLKQRLD
860 870 880 890 900
LMREMYDRAG EVASSAQDDS ETTMTGSDPF YDRFHWFKLV GSSPIFHGCV
910 920 930 940 950
NERLADRTPS PTFSTADSDI TELADEQQDA MEDFDDEAFV DDTGSDAGTE
960 970 980 990 1000
EGSELFSDGH DPFYDRSPWF ILVGRAFVYL SNLLYPVPLI HRVAIVSEKG
1010 1020 1030 1040 1050
EVRGFLRVAV QAIAADEEAP DYGSGIRQSG TAKISFDNEY FNQSDFSSAA
1060 1070 1080 1090 1100
MTRSGLSLEE LRIVEGQGQS SEVISPPEEV NRMNDLDLKS GTLLDGKMVM
1110 1120 1130 1140 1150
EGFSEEIGNH LKLGSAFTFR VTVLQASGIL PEYADIFCQF NFLHRHDEAF
1160 1170 1180 1190 1200
STEPLKNNGR GSPLGFYHVQ NIAVEVTESF VDYIKTKPIV FEVFGHYQQH
1210 1220 1230 1240 1250
PLHLQGQDLN SPPQPSRRFF PPPMPLSKPV PATKLNTMNK TTLGQSMSKY
1260 1270 1280 1290 1300
DLLVWFEISE LEPTGEYIPA VVDHTAGLPC QGTFLLHQGI QRRITVTIIH
1310 1320 1330 1340 1350
EKGSELHWKD VRELVVGRIR NKPEVDEAAV DAVLSLNIIS AKSLKAAHSS
1360 1370 1380 1390 1400
SRTFYRFEAV WDSSLHNSLL LNRVTPYGEK IYMTLSAYLE LDHCIQPAVI
1410 1420 1430 1440 1450
TKDVCMVFYS RDAKISPPRS LRNLFGSGYS KSPDSNRVTG IYELSLCKMA
1460 1470 1480 1490 1500
DTGSPGMQRR RRKVLDTSVA YVRGEENLAG WRPRGDSLIL EHQWELEKLE
1510 1520 1530 1540 1550
LLHEVEKTRH FLLLRERLGD SVPKSLSDSL SPSLSSGTLS TSTSISSQIS
1560 1570 1580 1590 1600
TTTFESAITP SESSGYDSAD VESLVDREKE LATKCLQLLT HTFNREFSQV
1610 1620 1630 1640 1650
HGSISDCKLS DISPIGRDPS VSSFSSSTLT PSSTCPSLVD SRSSSMDQKT
1660 1670 1680 1690 1700
PEANSRASSP CQEFEQFQIV PTVETPYLAR AGKNEFLNLV PDIEEVRAGS
1710 1720 1730 1740 1750
VVSKKGYLHF KEPLSSNWAK HFVVVRRPYV FIYNSDKDPV ERGIINLSTA
1760 1770 1780 1790 1800
QVEYSEDQQA MVKTPNTFAV CTKHRGVLLQ ALNDKDMNDW LYAFNPLLAG
1810
TIRSKLSRRC PSQPKY
Length:1,816
Mass (Da):204,081
Last modified:January 11, 2001 - v2
Checksum:iE316EC295138E5DE
GO
Isoform 2 (identifier: Q60575-2) [UniParc]FASTAAdd to basket
Also known as: Beta

The sequence of this isoform differs from the canonical sequence as follows:
     289-294: Missing.
     394-434: IDPLIDDYSGSGGKYLKDFQNNKHRYLLASENQRPGNFSTA → T

Show »
Length:1,770
Mass (Da):198,920
Checksum:i2F8B32554B155ABA
GO
Isoform 3 (identifier: Q60575-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     289-294: Missing.
     394-434: IDPLIDDYSGSGGKYLKDFQNNKHRYLLASENQRPGNFSTA → T
     707-1196: YESKLQALQR...KPIVFEVFGH → ADSDSGDDSD...NLKAGRETTV
     1197-1816: Missing.

Show »
Length:1,150
Mass (Da):130,123
Checksum:i5BD3E9667325EE86
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A2AH75A2AH75_MOUSE
Kinesin family member 1B, isoform C...
Kif1b mCG_141691
1,150Annotation score:
F6XNB6F6XNB6_MOUSE
Kinesin-like protein KIF1B
Kif1b
495Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti117G → V (PubMed:7528108).Curated1
Sequence conflicti117G → V (PubMed:10571041).Curated1
Sequence conflicti520 – 523GGTL → RGDI in BAA04503 (PubMed:7528108).Curated4
Sequence conflicti909P → S in BAA75243 (Ref. 4) Curated1
Sequence conflicti1608 – 1609KL → TW in AAD39438 (PubMed:10341097).Curated2
Sequence conflicti1612I → V in AAD39438 (PubMed:10341097).Curated1
Sequence conflicti1784D → G in BAA75243 (Ref. 4) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_002862289 – 294Missing in isoform 2 and isoform 3. 2 Publications6
Alternative sequenceiVSP_002863394 – 434IDPLI…NFSTA → T in isoform 2 and isoform 3. 2 PublicationsAdd BLAST41
Alternative sequenceiVSP_002864707 – 1196YESKL…EVFGH → ADSDSGDDSDKRSCEESWKL ITSLREKLPPSKLQTIVKKC GLPSSGKKREPIKMYQIPQR RRLSKDSKWVTISDLKIQAV KEICYEVALNDFRHSRQEIE ALAIVKMKELCAMYGKKDPN ERDSWRAVARDVWDTVGVGD EKIEDMMVTGKGGTDVDDLK VHIDKLEDILQEVKKQNNMK DEEIKVLRNKMLKMEKVLPL IGSQEQKSQGSHKTKEPLVA GANSVSDNGVSKGESGELGK EERVSQLMNGDPAFRRGRLR WMRQEQIRFKNLQQQEITKQ LRRQNVPHRFIPPENRKPRF PFKSNPKHRNSWSPGTHIII TEDEVIELRIPKDEEGRKEN KEESQEKVGRAASRDVQSAW GTRSQDHIQVSKQHISNQQP PPQLRWRSNSLNNGQPKTTR CQATASSESLNSHSGHPTAD LQTFQAKRHIHQHRQPYCNY NTGGQVEGSTASCCQKQTDK PSHCNQFVTPPRMRRQFSAP NLKAGRETTV in isoform 3. 1 PublicationAdd BLAST490
Alternative sequenceiVSP_0028651197 – 1816Missing in isoform 3. 1 PublicationAdd BLAST620

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D17577 mRNA Translation: BAA04503.1
AF090190 mRNA Translation: AAF06718.1
AF131865 mRNA Translation: AAD39438.1
AB023656 mRNA Translation: BAA75243.1
CCDSiCCDS18956.1 [Q60575-2]
CCDS18957.1 [Q60575-3]
CCDS71521.1 [Q60575-1]
PIRiA55289
RefSeqiNP_001277924.1, NM_001290995.1 [Q60575-1]
NP_032467.2, NM_008441.2
UniGeneiMm.402393
Mm.474289

Genome annotation databases

EnsembliENSMUST00000055647; ENSMUSP00000061472; ENSMUSG00000063077 [Q60575-2]
ENSMUST00000060537; ENSMUSP00000056754; ENSMUSG00000063077 [Q60575-1]
GeneIDi16561
KEGGimmu:16561
UCSCiuc008vvy.2 mouse [Q60575-2]
uc008vvz.2 mouse [Q60575-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D17577 mRNA Translation: BAA04503.1
AF090190 mRNA Translation: AAF06718.1
AF131865 mRNA Translation: AAD39438.1
AB023656 mRNA Translation: BAA75243.1
CCDSiCCDS18956.1 [Q60575-2]
CCDS18957.1 [Q60575-3]
CCDS71521.1 [Q60575-1]
PIRiA55289
RefSeqiNP_001277924.1, NM_001290995.1 [Q60575-1]
NP_032467.2, NM_008441.2
UniGeneiMm.402393
Mm.474289

3D structure databases

ProteinModelPortaliQ60575
SMRiQ60575
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi200936, 8 interactors
IntActiQ60575, 6 interactors
STRINGi10090.ENSMUSP00000061472

PTM databases

iPTMnetiQ60575
PhosphoSitePlusiQ60575

Proteomic databases

PaxDbiQ60575
PeptideAtlasiQ60575
PRIDEiQ60575

Protocols and materials databases

DNASUi16561
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000055647; ENSMUSP00000061472; ENSMUSG00000063077 [Q60575-2]
ENSMUST00000060537; ENSMUSP00000056754; ENSMUSG00000063077 [Q60575-1]
GeneIDi16561
KEGGimmu:16561
UCSCiuc008vvy.2 mouse [Q60575-2]
uc008vvz.2 mouse [Q60575-1]

Organism-specific databases

CTDi23095
MGIiMGI:108426 Kif1b

Phylogenomic databases

eggNOGiKOG0245 Eukaryota
COG5059 LUCA
GeneTreeiENSGT00930000150817
HOGENOMiHOG000165968
HOVERGENiHBG052251
InParanoidiQ60575
KOiK10392
OMAiLHQEDEF
OrthoDBiEOG091G009V
PhylomeDBiQ60575
TreeFamiTF105221

Enzyme and pathway databases

ReactomeiR-MMU-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-MMU-983189 Kinesins

Miscellaneous databases

ChiTaRSiKif1b mouse
PROiPR:Q60575
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000063077 Expressed in 309 organ(s), highest expression level in retina
CleanExiMM_KIF1B
ExpressionAtlasiQ60575 baseline and differential
GenevisibleiQ60575 MM

Family and domain databases

CDDicd00060 FHA, 1 hit
Gene3Di2.30.29.30, 1 hit
3.40.850.10, 1 hit
InterProiView protein in InterPro
IPR000253 FHA_dom
IPR022164 Kinesin-like
IPR027640 Kinesin-like_fam
IPR022140 Kinesin-like_KIF1-typ
IPR032405 Kinesin_assoc
IPR019821 Kinesin_motor_CS
IPR001752 Kinesin_motor_dom
IPR036961 Kinesin_motor_dom_sf
IPR027417 P-loop_NTPase
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR008984 SMAD_FHA_dom_sf
PANTHERiPTHR24115 PTHR24115, 1 hit
PfamiView protein in Pfam
PF12473 DUF3694, 1 hit
PF00498 FHA, 1 hit
PF12423 KIF1B, 1 hit
PF00225 Kinesin, 1 hit
PF16183 Kinesin_assoc, 1 hit
PF00169 PH, 1 hit
PRINTSiPR00380 KINESINHEAVY
SMARTiView protein in SMART
SM00240 FHA, 1 hit
SM00129 KISc, 1 hit
SM00233 PH, 1 hit
SUPFAMiSSF49879 SSF49879, 1 hit
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50006 FHA_DOMAIN, 1 hit
PS00411 KINESIN_MOTOR_1, 1 hit
PS50067 KINESIN_MOTOR_2, 1 hit
PS50003 PH_DOMAIN, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiKIF1B_MOUSE
AccessioniPrimary (citable) accession number: Q60575
Secondary accession number(s): Q9R0B4, Q9WVE5, Q9Z119
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: January 11, 2001
Last modified: November 7, 2018
This is version 158 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again