Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 171 (02 Dec 2020)
Sequence version 2 (11 Jan 2001)
Previous versions | rss
Add a publicationFeedback
Protein

Kinesin-like protein KIF1B

Gene

Kif1b

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Motor for anterograde transport of mitochondria. Has a microtubule plus end-directed motility.
Isoform 1 mediates the transport of synaptic vesicles in neuronal cells.By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi97 – 104ATPPROSITE-ProRule annotation8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMotor protein
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-2132295, MHC class II antigen presentation
R-MMU-6811434, COPI-dependent Golgi-to-ER retrograde traffic
R-MMU-983189, Kinesins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Kinesin-like protein KIF1B
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Kif1b
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:108426, Kif1b

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Microtubule, Mitochondrion, Synapse

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001254082 – 1816Kinesin-like protein KIF1BAdd BLAST1815

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineBy similarity1
Modified residuei647PhosphothreonineCombined sources1
Modified residuei652PhosphothreonineCombined sources1
Modified residuei1054PhosphoserineBy similarity1
Modified residuei1057PhosphoserineBy similarity1
Modified residuei1416PhosphoserineBy similarity1
Modified residuei1454PhosphoserineCombined sources1
Modified residuei1487PhosphoserineCombined sources1
Modified residuei1573PhosphoserineBy similarity1
Modified residuei1603PhosphoserineBy similarity1
Modified residuei1610PhosphoserineBy similarity1
Modified residuei1613PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q60575

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q60575

PeptideAtlas

More...
PeptideAtlasi
Q60575

PRoteomics IDEntifications database

More...
PRIDEi
Q60575

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q60575

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q60575

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed almost exclusively in adult brain tissue (mainly in the cerebellum and cerebrum) within a single type of neuronal cell.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000063077, Expressed in retina and 324 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q60575, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q60575, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer (PubMed:7528108).

Interacts with KIFBP (By similarity).

Interacts (via C-terminus end of the kinesin-motor domain) with CHP1; the interaction occurs in a calcium-dependent manner (By similarity).

By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
200936, 8 interactors

Protein interaction database and analysis system

More...
IntActi
Q60575, 6 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000061472

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q60575, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q60575

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini5 – 354Kinesin motorPROSITE-ProRule annotationAdd BLAST350
Domaini556 – 612FHAPROSITE-ProRule annotationAdd BLAST57
Domaini1702 – 1799PHPROSITE-ProRule annotationAdd BLAST98

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni270 – 350Interaction with KBPBy similarityAdd BLAST81

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili365 – 386Sequence analysisAdd BLAST22
Coiled coili470 – 502Sequence analysisAdd BLAST33
Coiled coili668 – 737Sequence analysisAdd BLAST70
Coiled coili841 – 869Sequence analysisAdd BLAST29

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family. Unc-104 subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0245, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157445

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_001485_10_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q60575

Identification of Orthologs from Complete Genome Data

More...
OMAi
LHQEDEF

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q60575

TreeFam database of animal gene trees

More...
TreeFami
TF105221

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00060, FHA, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit
3.40.850.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000253, FHA_dom
IPR022164, Kinesin-like
IPR027640, Kinesin-like_fam
IPR022140, Kinesin-like_KIF1-typ
IPR032405, Kinesin_assoc
IPR019821, Kinesin_motor_CS
IPR001752, Kinesin_motor_dom
IPR036961, Kinesin_motor_dom_sf
IPR027417, P-loop_NTPase
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR008984, SMAD_FHA_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR24115, PTHR24115, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12473, DUF3694, 1 hit
PF00498, FHA, 1 hit
PF12423, KIF1B, 1 hit
PF00225, Kinesin, 1 hit
PF16183, Kinesin_assoc, 1 hit
PF00169, PH, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00380, KINESINHEAVY

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00240, FHA, 1 hit
SM00129, KISc, 1 hit
SM00233, PH, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49879, SSF49879, 1 hit
SSF52540, SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50006, FHA_DOMAIN, 1 hit
PS00411, KINESIN_MOTOR_1, 1 hit
PS50067, KINESIN_MOTOR_2, 1 hit
PS50003, PH_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q60575-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSGASVKVAV RVRPFNSRET SKESKCIIQM QGNSTSIINP KNPKEAPKSF
60 70 80 90 100
SFDYSYWSHT SPEDPCFASQ NRVYNDIGKE MLLHAFEGYN VCIFAYGQTG
110 120 130 140 150
AGKSYTMMGK QEESQAGIIP QLCEELFEKI NDNCNEEMSY SVEVSYMEIY
160 170 180 190 200
CERVRDLLNP KNKGNLRVRE HPLLGPYVED LSKLAVTSYT DIADLMDAGN
210 220 230 240 250
KARTVAATNM NETSSRSHAV FTIVFTQKKQ DPETNLSTEK VSKISLVDLA
260 270 280 290 300
GSERADSTGA KGTRLKEGAN INKSLTTLGK VISALAEVDN CTSKSKKKKK
310 320 330 340 350
TDFIPYRDSV LTWLLRENLG GNSRTAMVAA LSPADINYDE TLSTLRYADR
360 370 380 390 400
AKQIKCNAVI NEDPNAKLVR ELKEEVTRLK DLLRAQGLGD IIDIDPLIDD
410 420 430 440 450
YSGSGGKYLK DFQNNKHRYL LASENQRPGN FSTASMGSLT SSPSSCSLNS
460 470 480 490 500
QVGLTSVTSI QERIMSTPGG EEAIERLKES EKIIAELNET WEEKLRKTEA
510 520 530 540 550
IRMEREALLA EMGVAIREDG GTLGVFSPKK TPHLVNLNED PLMSECLLYY
560 570 580 590 600
IKDGITRVGQ ADAERRQDIV LSGAHIKEEH CLFRSERSNT GEVIVTLEPC
610 620 630 640 650
ERSETYVNGK RVAHPVQLRS GNRIIMGKNH VFRFNHPEQA RAEREKTPSA
660 670 680 690 700
ETPSEPVDWT FAQRELLEKQ GIDMKQEMEK RLQEMEILYK KEKEEADLLL
710 720 730 740 750
EQQRLDYESK LQALQRQVET RSLAAETTEE EEEEEEVPWT QHEFELAQWA
760 770 780 790 800
FRKWKSHQFT SLRDLLWGNA VYLKEANAIS VELKKKVQFQ FVLLTDTLYS
810 820 830 840 850
PVPPELLPSE MEKTHEDRPF PRTVVAVEVQ DLKNGATHYW SLDKLKQRLD
860 870 880 890 900
LMREMYDRAG EVASSAQDDS ETTMTGSDPF YDRFHWFKLV GSSPIFHGCV
910 920 930 940 950
NERLADRTPS PTFSTADSDI TELADEQQDA MEDFDDEAFV DDTGSDAGTE
960 970 980 990 1000
EGSELFSDGH DPFYDRSPWF ILVGRAFVYL SNLLYPVPLI HRVAIVSEKG
1010 1020 1030 1040 1050
EVRGFLRVAV QAIAADEEAP DYGSGIRQSG TAKISFDNEY FNQSDFSSAA
1060 1070 1080 1090 1100
MTRSGLSLEE LRIVEGQGQS SEVISPPEEV NRMNDLDLKS GTLLDGKMVM
1110 1120 1130 1140 1150
EGFSEEIGNH LKLGSAFTFR VTVLQASGIL PEYADIFCQF NFLHRHDEAF
1160 1170 1180 1190 1200
STEPLKNNGR GSPLGFYHVQ NIAVEVTESF VDYIKTKPIV FEVFGHYQQH
1210 1220 1230 1240 1250
PLHLQGQDLN SPPQPSRRFF PPPMPLSKPV PATKLNTMNK TTLGQSMSKY
1260 1270 1280 1290 1300
DLLVWFEISE LEPTGEYIPA VVDHTAGLPC QGTFLLHQGI QRRITVTIIH
1310 1320 1330 1340 1350
EKGSELHWKD VRELVVGRIR NKPEVDEAAV DAVLSLNIIS AKSLKAAHSS
1360 1370 1380 1390 1400
SRTFYRFEAV WDSSLHNSLL LNRVTPYGEK IYMTLSAYLE LDHCIQPAVI
1410 1420 1430 1440 1450
TKDVCMVFYS RDAKISPPRS LRNLFGSGYS KSPDSNRVTG IYELSLCKMA
1460 1470 1480 1490 1500
DTGSPGMQRR RRKVLDTSVA YVRGEENLAG WRPRGDSLIL EHQWELEKLE
1510 1520 1530 1540 1550
LLHEVEKTRH FLLLRERLGD SVPKSLSDSL SPSLSSGTLS TSTSISSQIS
1560 1570 1580 1590 1600
TTTFESAITP SESSGYDSAD VESLVDREKE LATKCLQLLT HTFNREFSQV
1610 1620 1630 1640 1650
HGSISDCKLS DISPIGRDPS VSSFSSSTLT PSSTCPSLVD SRSSSMDQKT
1660 1670 1680 1690 1700
PEANSRASSP CQEFEQFQIV PTVETPYLAR AGKNEFLNLV PDIEEVRAGS
1710 1720 1730 1740 1750
VVSKKGYLHF KEPLSSNWAK HFVVVRRPYV FIYNSDKDPV ERGIINLSTA
1760 1770 1780 1790 1800
QVEYSEDQQA MVKTPNTFAV CTKHRGVLLQ ALNDKDMNDW LYAFNPLLAG
1810
TIRSKLSRRC PSQPKY
Length:1,816
Mass (Da):204,081
Last modified:January 11, 2001 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE316EC295138E5DE
GO
Isoform 2 (identifier: Q60575-2) [UniParc]FASTAAdd to basket
Also known as: Beta

The sequence of this isoform differs from the canonical sequence as follows:
     289-294: Missing.
     394-434: IDPLIDDYSGSGGKYLKDFQNNKHRYLLASENQRPGNFSTA → T

Show »
Length:1,770
Mass (Da):198,920
Checksum:i2F8B32554B155ABA
GO
Isoform 3 (identifier: Q60575-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     289-294: Missing.
     394-434: IDPLIDDYSGSGGKYLKDFQNNKHRYLLASENQRPGNFSTA → T
     707-1196: YESKLQALQR...KPIVFEVFGH → ADSDSGDDSD...NLKAGRETTV
     1197-1816: Missing.

Show »
Length:1,150
Mass (Da):130,123
Checksum:i5BD3E9667325EE86
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A5F8MPF0A0A5F8MPF0_MOUSE
Kinesin-like protein KIF1B
Kif1b
1,883Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2AH75A2AH75_MOUSE
Kinesin-like protein KIF1B
Kif1b
1,150Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6XNB6F6XNB6_MOUSE
Kinesin-like protein KIF1B
Kif1b
495Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti117G → V (PubMed:7528108).Curated1
Sequence conflicti117G → V (PubMed:10571041).Curated1
Sequence conflicti520 – 523GGTL → RGDI in BAA04503 (PubMed:7528108).Curated4
Sequence conflicti909P → S in BAA75243 (Ref. 4) Curated1
Sequence conflicti1608 – 1609KL → TW in AAD39438 (PubMed:10341097).Curated2
Sequence conflicti1612I → V in AAD39438 (PubMed:10341097).Curated1
Sequence conflicti1784D → G in BAA75243 (Ref. 4) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_002862289 – 294Missing in isoform 2 and isoform 3. 2 Publications6
Alternative sequenceiVSP_002863394 – 434IDPLI…NFSTA → T in isoform 2 and isoform 3. 2 PublicationsAdd BLAST41
Alternative sequenceiVSP_002864707 – 1196YESKL…EVFGH → ADSDSGDDSDKRSCEESWKL ITSLREKLPPSKLQTIVKKC GLPSSGKKREPIKMYQIPQR RRLSKDSKWVTISDLKIQAV KEICYEVALNDFRHSRQEIE ALAIVKMKELCAMYGKKDPN ERDSWRAVARDVWDTVGVGD EKIEDMMVTGKGGTDVDDLK VHIDKLEDILQEVKKQNNMK DEEIKVLRNKMLKMEKVLPL IGSQEQKSQGSHKTKEPLVA GANSVSDNGVSKGESGELGK EERVSQLMNGDPAFRRGRLR WMRQEQIRFKNLQQQEITKQ LRRQNVPHRFIPPENRKPRF PFKSNPKHRNSWSPGTHIII TEDEVIELRIPKDEEGRKEN KEESQEKVGRAASRDVQSAW GTRSQDHIQVSKQHISNQQP PPQLRWRSNSLNNGQPKTTR CQATASSESLNSHSGHPTAD LQTFQAKRHIHQHRQPYCNY NTGGQVEGSTASCCQKQTDK PSHCNQFVTPPRMRRQFSAP NLKAGRETTV in isoform 3. 1 PublicationAdd BLAST490
Alternative sequenceiVSP_0028651197 – 1816Missing in isoform 3. 1 PublicationAdd BLAST620

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D17577 mRNA Translation: BAA04503.1
AF090190 mRNA Translation: AAF06718.1
AF131865 mRNA Translation: AAD39438.1
AB023656 mRNA Translation: BAA75243.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS18956.1 [Q60575-2]
CCDS18957.1 [Q60575-3]
CCDS71521.1 [Q60575-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
A55289

NCBI Reference Sequences

More...
RefSeqi
NP_001277924.1, NM_001290995.1 [Q60575-1]
NP_032467.2, NM_008441.2

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000055647; ENSMUSP00000061472; ENSMUSG00000063077 [Q60575-2]
ENSMUST00000060537; ENSMUSP00000056754; ENSMUSG00000063077 [Q60575-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
16561

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:16561

UCSC genome browser

More...
UCSCi
uc008vvy.2, mouse [Q60575-2]
uc008vvz.2, mouse [Q60575-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D17577 mRNA Translation: BAA04503.1
AF090190 mRNA Translation: AAF06718.1
AF131865 mRNA Translation: AAD39438.1
AB023656 mRNA Translation: BAA75243.1
CCDSiCCDS18956.1 [Q60575-2]
CCDS18957.1 [Q60575-3]
CCDS71521.1 [Q60575-1]
PIRiA55289
RefSeqiNP_001277924.1, NM_001290995.1 [Q60575-1]
NP_032467.2, NM_008441.2

3D structure databases

SMRiQ60575
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi200936, 8 interactors
IntActiQ60575, 6 interactors
STRINGi10090.ENSMUSP00000061472

PTM databases

iPTMnetiQ60575
PhosphoSitePlusiQ60575

Proteomic databases

jPOSTiQ60575
PaxDbiQ60575
PeptideAtlasiQ60575
PRIDEiQ60575

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
4196, 104 antibodies

The DNASU plasmid repository

More...
DNASUi
16561

Genome annotation databases

EnsembliENSMUST00000055647; ENSMUSP00000061472; ENSMUSG00000063077 [Q60575-2]
ENSMUST00000060537; ENSMUSP00000056754; ENSMUSG00000063077 [Q60575-1]
GeneIDi16561
KEGGimmu:16561
UCSCiuc008vvy.2, mouse [Q60575-2]
uc008vvz.2, mouse [Q60575-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23095
MGIiMGI:108426, Kif1b

Phylogenomic databases

eggNOGiKOG0245, Eukaryota
GeneTreeiENSGT00940000157445
HOGENOMiCLU_001485_10_0_1
InParanoidiQ60575
OMAiLHQEDEF
PhylomeDBiQ60575
TreeFamiTF105221

Enzyme and pathway databases

ReactomeiR-MMU-2132295, MHC class II antigen presentation
R-MMU-6811434, COPI-dependent Golgi-to-ER retrograde traffic
R-MMU-983189, Kinesins

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
16561, 2 hits in 17 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Kif1b, mouse

Protein Ontology

More...
PROi
PR:Q60575
RNActiQ60575, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000063077, Expressed in retina and 324 other tissues
ExpressionAtlasiQ60575, baseline and differential
GenevisibleiQ60575, MM

Family and domain databases

CDDicd00060, FHA, 1 hit
Gene3Di2.30.29.30, 1 hit
3.40.850.10, 1 hit
InterProiView protein in InterPro
IPR000253, FHA_dom
IPR022164, Kinesin-like
IPR027640, Kinesin-like_fam
IPR022140, Kinesin-like_KIF1-typ
IPR032405, Kinesin_assoc
IPR019821, Kinesin_motor_CS
IPR001752, Kinesin_motor_dom
IPR036961, Kinesin_motor_dom_sf
IPR027417, P-loop_NTPase
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR008984, SMAD_FHA_dom_sf
PANTHERiPTHR24115, PTHR24115, 1 hit
PfamiView protein in Pfam
PF12473, DUF3694, 1 hit
PF00498, FHA, 1 hit
PF12423, KIF1B, 1 hit
PF00225, Kinesin, 1 hit
PF16183, Kinesin_assoc, 1 hit
PF00169, PH, 1 hit
PRINTSiPR00380, KINESINHEAVY
SMARTiView protein in SMART
SM00240, FHA, 1 hit
SM00129, KISc, 1 hit
SM00233, PH, 1 hit
SUPFAMiSSF49879, SSF49879, 1 hit
SSF52540, SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50006, FHA_DOMAIN, 1 hit
PS00411, KINESIN_MOTOR_1, 1 hit
PS50067, KINESIN_MOTOR_2, 1 hit
PS50003, PH_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKIF1B_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q60575
Secondary accession number(s): Q9R0B4, Q9WVE5, Q9Z119
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: January 11, 2001
Last modified: December 2, 2020
This is version 171 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again