Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 160 (07 Oct 2020)
Sequence version 2 (27 Jul 2011)
Previous versions | rss
Add a publicationFeedback
Protein

Semaphorin-5B

Gene

Sema5b

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May act as positive axonal guidance cues.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processDifferentiation, Neurogenesis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-5173214, O-glycosylation of TSR domain-containing proteins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Semaphorin-5B
Alternative name(s):
Semaphorin-G
Short name:
Sema G
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Sema5b
Synonyms:Kiaa1445, Semag, SemG
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:107555, Sema5b

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini20 – 978ExtracellularSequence analysisAdd BLAST959
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei979 – 999HelicalSequence analysisAdd BLAST21
Topological domaini1000 – 1093CytoplasmicSequence analysisAdd BLAST94

Keywords - Cellular componenti

Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 19Sequence analysisAdd BLAST19
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000003233820 – 1093Semaphorin-5BAdd BLAST1074

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi59N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi95N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi114 ↔ 124By similarity
Disulfide bondi141 ↔ 150By similarity
Glycosylationi157N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi178N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi264 ↔ 367By similarity
Glycosylationi287N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi288 ↔ 330By similarity
Glycosylationi333N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi378N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi498 ↔ 515By similarity
Disulfide bondi507 ↔ 524By similarity
Glycosylationi532N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi539N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi547N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi602N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi618 ↔ 655By similarity
Disulfide bondi622 ↔ 661By similarity
Disulfide bondi633 ↔ 645By similarity
Disulfide bondi676 ↔ 707By similarity
Disulfide bondi680 ↔ 712By similarity
Disulfide bondi691 ↔ 697By similarity
Glycosylationi728N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi807 ↔ 844By similarity
Disulfide bondi811 ↔ 849By similarity
Disulfide bondi822 ↔ 834By similarity
Disulfide bondi864 ↔ 901By similarity
Disulfide bondi868 ↔ 906By similarity
Disulfide bondi879 ↔ 891By similarity
Glycosylationi944N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q60519

PRoteomics IDEntifications database

More...
PRIDEi
Q60519

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q60519, 13 sites

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q60519

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q60519

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

In adult, only detected in brain.

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Differentially expressed in embryonic and adult tissues. Its abundance decreases from 10 dpc to birth.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000052133, Expressed in midbrain and 173 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q60519, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
203172, 4 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000057494

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q60519, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini45 – 495SemaPROSITE-ProRule annotationAdd BLAST451
Domaini551 – 605TSP type-1 1PROSITE-ProRule annotationAdd BLAST55
Domaini606 – 662TSP type-1 2PROSITE-ProRule annotationAdd BLAST57
Domaini664 – 713TSP type-1 3PROSITE-ProRule annotationAdd BLAST50
Domaini721 – 776TSP type-1 4PROSITE-ProRule annotationAdd BLAST56
Domaini795 – 850TSP type-1 5PROSITE-ProRule annotationAdd BLAST56
Domaini852 – 907TSP type-1 6PROSITE-ProRule annotationAdd BLAST56
Domaini908 – 952TSP type-1 7PROSITE-ProRule annotationAdd BLAST45

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the semaphorin family.Curated

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3611, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156712

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_005410_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q60519

KEGG Orthology (KO)

More...
KOi
K06841

Identification of Orthologs from Complete Genome Data

More...
OMAi
AICAFNM

Database of Orthologous Groups

More...
OrthoDBi
64683at2759

TreeFam database of animal gene trees

More...
TreeFami
TF329951

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.10, 1 hit
2.20.100.10, 5 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016201, PSI
IPR001627, Semap_dom
IPR036352, Semap_dom_sf
IPR027231, Semaphorin
IPR000884, TSP1_rpt
IPR036383, TSP1_rpt_sf
IPR015943, WD40/YVTN_repeat-like_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR11036, PTHR11036, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01403, Sema, 1 hit
PF00090, TSP_1, 5 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00423, PSI, 1 hit
SM00630, Sema, 1 hit
SM00209, TSP1, 5 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF101912, SSF101912, 1 hit
SSF82895, SSF82895, 4 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51004, SEMA, 1 hit
PS50092, TSP1, 5 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q60519-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVVPGPLALS LLLSSLTLLV SHLSSSQDIA SESSSEQQMC TRREHPIVAF
60 70 80 90 100
EDLKPWVFNF TYPGVRDFSQ LALDPSRNQL IVGARNYLFR LSLANVSLLQ
110 120 130 140 150
ATEWASSEDT RRSCQSKGKT EEECQNYVRV LIVSGRKVFM CGTNAFSPVC
160 170 180 190 200
SSRQVGNLSR TIEKINGVAR CPYDPRHNST AVISSQGELY AATVIDFSGR
210 220 230 240 250
DPAIYRSLGS GPPLRTAQYN SKWLNEPNFV AAFDIGLFAY FFLRENAVEH
260 270 280 290 300
DCGRTVYSRV ARVCKNDVGG RFLLEDTWTT FMKARLNCSR PGEVPFYYNE
310 320 330 340 350
LQSAFHLPEQ DLIYGVFTTN VNSIAASAVC AFNLSAISKA FNGPFRYQEN
360 370 380 390 400
PRAAWLPIAN PIPNFQCGTL PETGPNENLT ERSLQDAQRL FLMSEAVQPV
410 420 430 440 450
TPEPCVTQDS VRFSHLVVDL VQAKDTLYHV LYIGTESGTI LKALSTASRS
460 470 480 490 500
LRGCYLEELH VLPPGRLEPL RSLRILHSAR ALFVGLSDRV LRVPLERCSA
510 520 530 540 550
YHSQGACLGA RDPYCGWDGK RQLCSTLEDS SNMSLWIQNI TTCPVRNVTR
560 570 580 590 600
DGGFGPWSPW KPCEHLDGDN SGSCLCRARS CDSPRPRCGG LECLGPSIHI
610 620 630 640 650
ANCSRNGAWT AWSSWAQCST SCGIGFQVRQ RSCSNPAPRH GGRICVGKSR
660 670 680 690 700
EERFCNENTP CPVPIFWASW GSWSKCSNNC GGGVQSRRRS CENGNSCPGC
710 720 730 740 750
GVEFKTCNPE ACPEVRRNTP WTPWLPVNVT QGGARQEQRF RFTCRAPLPD
760 770 780 790 800
PHGLQFGKRR TETRTCPADG TGACDTDALV EDLLRSGSTS PHTLNGGWAT
810 820 830 840 850
WGPWSSCSRD CELGFRVRKR TCTNPEPRNG GLPCVGDAAE YQDCNPQACP
860 870 880 890 900
VRGAWSCWTA WSQCSASCGG GHYQRTRSCT SPAPSPGEDI CLGLHTEEAL
910 920 930 940 950
CSTQACPEGW SLWSEWGVCT EDGAQSRSRS CEELLPGPGA CVGNSSQSRP
960 970 980 990 1000
CPYSEIPVIL PASSVEETTS CGGFNLIHLI VTGVSCFLVS GLLTLAVYLS
1010 1020 1030 1040 1050
CQHCQRQSQE STLVHPATPN HLHYKGGGTP KNEKYTPMEF KTLNKNNLIP
1060 1070 1080 1090
DDRANFYPLQ QTNVYTTTYY PSPLNKPSFR PEASPGQRCF PNS
Length:1,093
Mass (Da):120,327
Last modified:July 27, 2011 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i512D73EEBC8959D2
GO
Isoform 2 (identifier: Q60519-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     908-908: Missing.
     1041-1093: KTLNKNNLIP...SPGQRCFPNS → TSEATRPSKGNIRCGPTLSSSCVELGNPAGGH

Show »
Length:1,071
Mass (Da):117,276
Checksum:iDE67C694296D96B3
GO
Isoform 3 (identifier: Q60519-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     702-702: V → VVRSRGWGAGSGETYSPGGVGGSEATLTPK

Show »
Length:1,122
Mass (Da):123,131
Checksum:i21D2C2F54C522450
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti84A → G in CAA66398 (PubMed:8817451).Curated1
Sequence conflicti493V → I in CAA66398 (PubMed:8817451).Curated1
Sequence conflicti791P → Q in BAC37350 (PubMed:16141072).Curated1
Sequence conflicti1006R → S in BAC37350 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_029466702V → VVRSRGWGAGSGETYSPGGV GGSEATLTPK in isoform 3. 1 Publication1
Alternative sequenceiVSP_029467908Missing in isoform 2. 1 Publication1
Alternative sequenceiVSP_0294681041 – 1093KTLNK…CFPNS → TSEATRPSKGNIRCGPTLSS SCVELGNPAGGH in isoform 2. 1 PublicationAdd BLAST53

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X97818 mRNA Translation: CAA66398.1
AC154653 Genomic DNA No translation available.
CT010576 Genomic DNA No translation available.
CH466521 Genomic DNA Translation: EDK97889.1
BC052397 mRNA Translation: AAH52397.1
AK129362 mRNA Translation: BAC98172.1
AK078659 mRNA Translation: BAC37350.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS28140.1 [Q60519-1]

NCBI Reference Sequences

More...
RefSeqi
NP_038689.2, NM_013661.2 [Q60519-1]
XP_006521932.1, XM_006521869.1 [Q60519-3]
XP_011244146.1, XM_011245844.1 [Q60519-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000050625; ENSMUSP00000057494; ENSMUSG00000052133 [Q60519-1]
ENSMUST00000120756; ENSMUSP00000112536; ENSMUSG00000052133 [Q60519-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
20357

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:20357

UCSC genome browser

More...
UCSCi
uc007zbm.2, mouse [Q60519-1]
uc012aez.1, mouse [Q60519-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X97818 mRNA Translation: CAA66398.1
AC154653 Genomic DNA No translation available.
CT010576 Genomic DNA No translation available.
CH466521 Genomic DNA Translation: EDK97889.1
BC052397 mRNA Translation: AAH52397.1
AK129362 mRNA Translation: BAC98172.1
AK078659 mRNA Translation: BAC37350.1
CCDSiCCDS28140.1 [Q60519-1]
RefSeqiNP_038689.2, NM_013661.2 [Q60519-1]
XP_006521932.1, XM_006521869.1 [Q60519-3]
XP_011244146.1, XM_011245844.1 [Q60519-3]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi203172, 4 interactors
STRINGi10090.ENSMUSP00000057494

PTM databases

GlyGeniQ60519, 13 sites
iPTMnetiQ60519
PhosphoSitePlusiQ60519

Proteomic databases

PaxDbiQ60519
PRIDEiQ60519

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
2250, 110 antibodies

Genome annotation databases

EnsembliENSMUST00000050625; ENSMUSP00000057494; ENSMUSG00000052133 [Q60519-1]
ENSMUST00000120756; ENSMUSP00000112536; ENSMUSG00000052133 [Q60519-3]
GeneIDi20357
KEGGimmu:20357
UCSCiuc007zbm.2, mouse [Q60519-1]
uc012aez.1, mouse [Q60519-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
54437
MGIiMGI:107555, Sema5b

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG3611, Eukaryota
GeneTreeiENSGT00940000156712
HOGENOMiCLU_005410_1_0_1
InParanoidiQ60519
KOiK06841
OMAiAICAFNM
OrthoDBi64683at2759
TreeFamiTF329951

Enzyme and pathway databases

ReactomeiR-MMU-5173214, O-glycosylation of TSR domain-containing proteins

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
20357, 1 hit in 18 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Sema5b, mouse

Protein Ontology

More...
PROi
PR:Q60519
RNActiQ60519, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000052133, Expressed in midbrain and 173 other tissues
GenevisibleiQ60519, MM

Family and domain databases

Gene3Di2.130.10.10, 1 hit
2.20.100.10, 5 hits
InterProiView protein in InterPro
IPR016201, PSI
IPR001627, Semap_dom
IPR036352, Semap_dom_sf
IPR027231, Semaphorin
IPR000884, TSP1_rpt
IPR036383, TSP1_rpt_sf
IPR015943, WD40/YVTN_repeat-like_dom_sf
PANTHERiPTHR11036, PTHR11036, 1 hit
PfamiView protein in Pfam
PF01403, Sema, 1 hit
PF00090, TSP_1, 5 hits
SMARTiView protein in SMART
SM00423, PSI, 1 hit
SM00630, Sema, 1 hit
SM00209, TSP1, 5 hits
SUPFAMiSSF101912, SSF101912, 1 hit
SSF82895, SSF82895, 4 hits
PROSITEiView protein in PROSITE
PS51004, SEMA, 1 hit
PS50092, TSP1, 5 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSEM5B_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q60519
Secondary accession number(s): B1B1A9
, Q6ZPQ8, Q7TT33, Q8BVE5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: July 27, 2011
Last modified: October 7, 2020
This is version 160 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again