Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 121 (08 May 2019)
Sequence version 2 (18 May 2010)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

F-box/WD repeat-containing protein 10

Gene

FBXW10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable substrate-recognition component of a SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Overexpression is leading to degradation of CBX5 and CBX1.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processUbl conjugation pathway

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-390471 Association of TriC/CCT with target proteins during biosynthesis
R-HSA-8951664 Neddylation
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q5XX13

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
F-box/WD repeat-containing protein 10
Alternative name(s):
F-box and WD-40 domain-containing protein 10
Ubiquitin ligase-specificity factor
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FBXW10
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1211 FBXW10

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611679 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5XX13

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
10517

Open Targets

More...
OpenTargetsi
ENSG00000171931

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25575

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FBXW10

Domain mapping of disease mutations (DMDM)

More...
DMDMi
296434504

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003158341 – 1052F-box/WD repeat-containing protein 10Add BLAST1052

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5XX13

PeptideAtlas

More...
PeptideAtlasi
Q5XX13

PRoteomics IDEntifications database

More...
PRIDEi
Q5XX13

ProteomicsDB human proteome resource

More...
ProteomicsDBi
65850
65851 [Q5XX13-2]
65852 [Q5XX13-3]
65853 [Q5XX13-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5XX13

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5XX13

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By disease-causing laminin A mutants also inducing CBX5 and CBX1 proteasomal degradation.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000171931 Expressed in 67 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5XX13 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5XX13 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA047457

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115772, 2 interactors

Protein interaction database and analysis system

More...
IntActi
Q5XX13, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000379025

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati169 – 206WD 1Add BLAST38
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini276 – 323F-boxAdd BLAST48
Repeati409 – 447WD 2Add BLAST39
Repeati451 – 490WD 3Add BLAST40
Repeati493 – 532WD 4Add BLAST40
Repeati534 – 569WD 5Add BLAST36
Repeati572 – 609WD 6Add BLAST38
Repeati611 – 652WD 7Add BLAST42

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili690 – 719Sequence analysisAdd BLAST30
Coiled coili986 – 1010Sequence analysisAdd BLAST25

Keywords - Domaini

Coiled coil, Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IQCZ Eukaryota
ENOG410Z8UQ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158003

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000082454

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5XX13

KEGG Orthology (KO)

More...
KOi
K10266

Identification of Orthologs from Complete Genome Data

More...
OMAi
KEWFRRI

Database of Orthologous Groups

More...
OrthoDBi
133791at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5XX13

TreeFam database of animal gene trees

More...
TreeFami
TF329175

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036047 F-box-like_dom_sf
IPR020472 G-protein_beta_WD-40_rep
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00400 WD40, 3 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00320 GPROTEINBRPT

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00320 WD40, 5 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50978 SSF50978, 1 hit
SSF81383 SSF81383, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 3 hits
PS50294 WD_REPEATS_REGION, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5XX13-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MENLESRLKN APYFRCEKGT DSIPLCRKCE TCVLAWKIFS TKEWFCRIND
60 70 80 90 100
ISQRRFLVGI LKQLNSLYLL HYFQNILQTT QGKDFIYNRS RINLSKKEGK
110 120 130 140 150
VVKSSLNQML DKTVEQKMKE ILYWFANSTQ WTKANYTLLL LQMCNPKLLL
160 170 180 190 200
TAANVIRVLF LREENNISGL NQDITDVCFS PEKDHSSKSA TSQVYWTAKT
210 220 230 240 250
QHTSLPLSKA PENEHLLGAA SNPEEPWRNS LRCISEMNRL FSGKGDITKP
260 270 280 290 300
GYDPCNLLVD LDDIRDLSSG FSKYRDFIRY LPIHLSKYIL RMLDRHTLNK
310 320 330 340 350
CASVSQHWAA MAQQVKMDLS AHGFIQNQIT FLQGSYTRGI DPNYANKVSI
360 370 380 390 400
PVPKMVDDGK SMRVKHPKWK LRTKNEYNLW TAYQNEETQQ VLIEERNVFC
410 420 430 440 450
GTYNVRILSD TWDQNRVIHY SGGDLIAVSS NRKIHLLDII QVKAIPVEFR
460 470 480 490 500
GHAGSVRALF LCEEENFLLS GSYDLSIRYW DLKSGVCTRI FGGHQGTITC
510 520 530 540 550
MDLCKNRLVS GGRDCQVKVW DVDTGKCLKT FRHKDPILAT RINDTYIVSS
560 570 580 590 600
CERGLVKVWH IAMAQLVKTL SGHEGAVKCL FFDQWHLLSG STDGLVMAWS
610 620 630 640 650
MVGKYERCLM AFKHPKEVLD VSLLFLRVIS ACADGKIRIY NFLNGNCMKV
660 670 680 690 700
LKANGRGDPV LSFFIQGNRM VVNTESNVLM FQFEHIKWQY AVEKTKQKKN
710 720 730 740 750
KEKEEEKEEN SLMEILSKCN IQVHSPRESV SSKQTVIQEL LPGKPPKSRV
760 770 780 790 800
LLKPAKFSSA VLIEELQSQG KSKSPRRDAD DVEKAQKQGQ LETPGKLPSH
810 820 830 840 850
PKKKSWKIPM SPDQFLLTVS ALQHAHNSGE FAYPCRPQTE ITDVWGPSIS
860 870 880 890 900
YPRKVLNFKG KSIQRAVDRL RLSNPPIDVK RTSIPLEIQK LQPNLKISLH
910 920 930 940 950
SPRVQSTIPQ PMIIRSRFSG SLKGGDQVTS SIERAVCSTG PLTSMQVIKP
960 970 980 990 1000
NRMLAPQVGT ATLSLKKERP RIYTALDPFR VNTEFVLLTV KEEKEHQEAK
1010 1020 1030 1040 1050
MKEYQAREST GVVDPGKVSK AAWIRKIKGL PIDNFTKQGK TAAPELGQNV

FI
Length:1,052
Mass (Da):119,846
Last modified:May 18, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC5FDFC2824E918F4
GO
Isoform 2 (identifier: Q5XX13-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     291-291: R → SMLGCMRGFPRHLPSWPSSGVSGSIFFFPG
     760-779: Missing.

Note: No experimental confirmation available.
Show »
Length:1,061
Mass (Da):120,720
Checksum:i952C029EEA85FAB9
GO
Isoform 3 (identifier: Q5XX13-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     617-669: Missing.

Note: No experimental confirmation available.
Show »
Length:999
Mass (Da):113,977
Checksum:i9EA51441C68F5BBB
GO
Isoform 4 (identifier: Q5XX13-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     779-779: Missing.

Note: No experimental confirmation available.
Show »
Length:1,051
Mass (Da):119,774
Checksum:i5281279CDC932BC9
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3QLH9J3QLH9_HUMAN
F-box/WD repeat-containing protein ...
FBXW10
196Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti236E → K in CAB66756 (PubMed:11230166).Curated1
Sequence conflicti275R → L in AAU43731 (PubMed:15520277).Curated1
Sequence conflicti275R → L in AAH28364 (PubMed:15489334).Curated1
Sequence conflicti413D → V in CAB66756 (PubMed:11230166).Curated1
Sequence conflicti638R → L in AAU43731 (PubMed:15520277).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03834123I → N1 PublicationCorresponds to variant dbSNP:rs11544711Ensembl.1
Natural variantiVAR_057600372R → G. Corresponds to variant dbSNP:rs7209610Ensembl.1
Natural variantiVAR_038342821A → T1 PublicationCorresponds to variant dbSNP:rs1026259Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_030727291R → SMLGCMRGFPRHLPSWPSSG VSGSIFFFPG in isoform 2. 1 Publication1
Alternative sequenceiVSP_030728617 – 669Missing in isoform 3. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_030729760 – 779Missing in isoform 2. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_039178779Missing in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY729024 mRNA Translation: AAU43731.1
AL136822 mRNA Translation: CAB66756.1
AC107982 Genomic DNA No translation available.
BC028364 mRNA Translation: AAH28364.1
BI828401 mRNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11199.3 [Q5XX13-1]
CCDS58524.1 [Q5XX13-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001254514.1, NM_001267585.1 [Q5XX13-1]
NP_001254515.1, NM_001267586.1 [Q5XX13-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000301938; ENSP00000306937; ENSG00000171931 [Q5XX13-3]
ENST00000308799; ENSP00000310382; ENSG00000171931 [Q5XX13-2]
ENST00000395665; ENSP00000379025; ENSG00000171931 [Q5XX13-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10517

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10517

UCSC genome browser

More...
UCSCi
uc002guk.4 human [Q5XX13-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY729024 mRNA Translation: AAU43731.1
AL136822 mRNA Translation: CAB66756.1
AC107982 Genomic DNA No translation available.
BC028364 mRNA Translation: AAH28364.1
BI828401 mRNA No translation available.
CCDSiCCDS11199.3 [Q5XX13-1]
CCDS58524.1 [Q5XX13-3]
RefSeqiNP_001254514.1, NM_001267585.1 [Q5XX13-1]
NP_001254515.1, NM_001267586.1 [Q5XX13-3]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi115772, 2 interactors
IntActiQ5XX13, 1 interactor
STRINGi9606.ENSP00000379025

PTM databases

iPTMnetiQ5XX13
PhosphoSitePlusiQ5XX13

Polymorphism and mutation databases

BioMutaiFBXW10
DMDMi296434504

Proteomic databases

PaxDbiQ5XX13
PeptideAtlasiQ5XX13
PRIDEiQ5XX13
ProteomicsDBi65850
65851 [Q5XX13-2]
65852 [Q5XX13-3]
65853 [Q5XX13-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000301938; ENSP00000306937; ENSG00000171931 [Q5XX13-3]
ENST00000308799; ENSP00000310382; ENSG00000171931 [Q5XX13-2]
ENST00000395665; ENSP00000379025; ENSG00000171931 [Q5XX13-1]
GeneIDi10517
KEGGihsa:10517
UCSCiuc002guk.4 human [Q5XX13-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10517
DisGeNETi10517

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FBXW10

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0013610
HGNCiHGNC:1211 FBXW10
HPAiHPA047457
MIMi611679 gene
neXtProtiNX_Q5XX13
OpenTargetsiENSG00000171931
PharmGKBiPA25575

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IQCZ Eukaryota
ENOG410Z8UQ LUCA
GeneTreeiENSGT00940000158003
HOGENOMiHOG000082454
InParanoidiQ5XX13
KOiK10266
OMAiKEWFRRI
OrthoDBi133791at2759
PhylomeDBiQ5XX13
TreeFamiTF329175

Enzyme and pathway databases

ReactomeiR-HSA-390471 Association of TriC/CCT with target proteins during biosynthesis
R-HSA-8951664 Neddylation
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
SignaLinkiQ5XX13

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
FBXW10

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10517

Protein Ontology

More...
PROi
PR:Q5XX13

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000171931 Expressed in 67 organ(s), highest expression level in testis
ExpressionAtlasiQ5XX13 baseline and differential
GenevisibleiQ5XX13 HS

Family and domain databases

Gene3Di2.130.10.10, 1 hit
InterProiView protein in InterPro
IPR036047 F-box-like_dom_sf
IPR020472 G-protein_beta_WD-40_rep
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PfamiView protein in Pfam
PF00400 WD40, 3 hits
PRINTSiPR00320 GPROTEINBRPT
SMARTiView protein in SMART
SM00320 WD40, 5 hits
SUPFAMiSSF50978 SSF50978, 1 hit
SSF81383 SSF81383, 1 hit
PROSITEiView protein in PROSITE
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 3 hits
PS50294 WD_REPEATS_REGION, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFBW10_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5XX13
Secondary accession number(s): C9JRY8
, C9JZD7, Q8TC00, Q9H0F0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: May 18, 2010
Last modified: May 8, 2019
This is version 121 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again