Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - Q5W0Z9 (ZDH20_HUMAN)

Entry version 144 (23 Feb 2022)
Sequence version 1 (07 Dec 2004)
Previous versions | rss
Add a publicationFeedback
Protein

Palmitoyltransferase ZDHHC20

Gene

ZDHHC20

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Palmitoyltransferase that could catalyze the addition of palmitate onto various protein substrates (PubMed:27153536, PubMed:29326245, PubMed:33219126).

Catalyzes palmitoylation of Cys residues in the cytoplasmic C-terminus of EGFR, and modulates the duration of EGFR signaling by modulating palmitoylation-dependent EGFR internalization and degradation (PubMed:27153536).

Has a preference for acyl-CoA with C16 fatty acid chains (PubMed:29326245).

Can also utilize acyl-CoA with C14 and C18 fatty acid chains (PubMed:29326245).

3 Publications

(Microbial infection) Dominant palmitoyltransferase responsible for lipidation of SARS coronavirus-2/SARS-CoV-2 spike protein. Through a sequential action with ZDHHC9, rapidly and efficiently palmitoylates spike protein following its synthesis in the endoplasmic reticulum (ER). In the infected cell, promotes spike biogenesis by protecting it from premature ER degradation, increases half-life and controls the lipid organization of its immediate membrane environment. Once the virus has formed, spike palmitoylation controls fusion with the target cell.

1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei29Important for selectivity toward medium-length fatty acids1 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi128Zinc 1Combined sources1 Publication1
Metal bindingi131Zinc 1Combined sources1 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei135Substrate1 Publication1
Metal bindingi141Zinc 1Combined sources1 Publication1
Metal bindingi142Zinc 2Combined sources1 Publication1
Metal bindingi145Zinc 2Combined sources1 Publication1
Metal bindingi148Zinc 1Combined sources1 Publication1
Metal bindingi155Zinc 2Combined sources1 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei156S-palmitoyl cysteine intermediate1 Publication1
Metal bindingi162Zinc 2Combined sources1 Publication1
Sitei181Important for selectivity toward medium-length fatty acids1 Publication1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionAcyltransferase, Transferase
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q5W0Z9

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q5W0Z9

Protein family/group databases

Transport Classification Database

More...TCDBi		8.A.114.1.6, the huntington-interacting protein 14 (hip14) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Palmitoyltransferase ZDHHC201 Publication (EC:2.3.1.2252 Publications)
Alternative name(s):
Acyltransferase ZDHHC201 Publication (EC:2.3.1.-1 Publication)
DHHC domain-containing cysteine-rich protein 201 Publication
Short name:
DHHC201 Publication
Zinc finger DHHC domain-containing protein 20Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZDHHC20Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 13

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:20749, ZDHHC20

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		617972, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q5W0Z9

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000180776

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 14Cytoplasmic1 PublicationAdd BLAST14
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei15 – 35Helical1 PublicationAdd BLAST21
Topological domaini36 – 53Lumenal1 PublicationAdd BLAST18
Transmembranei54 – 74Helical1 PublicationAdd BLAST21
Topological domaini75 – 169Cytoplasmic1 PublicationAdd BLAST95
Transmembranei170 – 190Helical1 PublicationAdd BLAST21
Topological domaini191 – 207Lumenal1 PublicationAdd BLAST17
Transmembranei208 – 231Helical1 PublicationAdd BLAST24
Topological domaini232 – 365Cytoplasmic1 PublicationAdd BLAST134

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Endoplasmic reticulum, Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi22I → W: Strongly reduced catalytic activity. 1 Publication1
Mutagenesisi29S → F: Strongly reduced catalytic activity. Enhances activity with acyl-CoA with C12 and C14 fatty acid chains. 1 Publication1
Mutagenesisi153D → A: Loss of catalytic activity. 1 Publication1
Mutagenesisi154H → A: Loss of catalytic activity. 1 Publication1
Mutagenesisi156C → S: Loss of catalytic activity. 1 Publication1
Mutagenesisi158W → A: Strongly reduced catalytic activity. 1 Publication1
Mutagenesisi171F → A: Loss of catalytic activity. 1 Publication1
Mutagenesisi174F → A: Strongly reduced catalytic activity. 1 Publication1
Mutagenesisi181Y → A: Moderately reduced catalytic activity. Enhances activity with acyl-CoA with C18 and C20 fatty acid chains. 1 Publication1
Mutagenesisi227L → W: Loss of catalytic activity. 1 Publication1
Mutagenesisi240 – 241TT → AA: Loss of catalytic activity. 1 Publication2
Mutagenesisi243E → A: Mildly reduced catalytic activity. 1 Publication1
Mutagenesisi266N → A: Strongly reduced catalytic activity. 1 Publication1
Mutagenesisi267Missing : Loss of catalytic activity. 1 Publication1
Mutagenesisi271F → A: Mildly reduced catalytic activity. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		253832

Open Targets

More...OpenTargetsi		ENSG00000180776

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134880838

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q5W0Z9, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ZDHHC20

Domain mapping of disease mutations (DMDM)

More...DMDMi		74748004

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002129061 – 365Palmitoyltransferase ZDHHC20Add BLAST365

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei305PhosphoserineCombined sources1
Modified residuei330PhosphoserineCombined sources1
Modified residuei339PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Autopalmitoylated (in vitro).1 Publication

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q5W0Z9

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q5W0Z9

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q5W0Z9

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q5W0Z9

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q5W0Z9

PeptideAtlas

More...PeptideAtlasi		Q5W0Z9

PRoteomics IDEntifications database

More...PRIDEi		Q5W0Z9

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		61482
65788 [Q5W0Z9-1]
65789 [Q5W0Z9-2]
65790 [Q5W0Z9-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q5W0Z9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q5W0Z9

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q5W0Z9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000180776, Expressed in upper arm skin and 224 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q5W0Z9, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q5W0Z9, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000180776, Tissue enhanced (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		128991, 28 interactors

Protein interaction database and analysis system

More...IntActi		Q5W0Z9, 11 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000371905

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q5W0Z9, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1365
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q5W0Z9

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini126 – 176DHHCPROSITE-ProRule annotationAdd BLAST51

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni140 – 143Substrate binding1 Publication4

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The DHHC domain is required for palmitoyltransferase activity.1 Publication

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the DHHC palmitoyltransferase family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1315, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000153716

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q5W0Z9

Identification of Orthologs from Complete Genome Data

More...OMAi		YLIFFHV

Database of Orthologous Groups

More...OrthoDBi		1491968at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q5W0Z9

TreeFam database of animal gene trees

More...TreeFami		TF316044

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001594, Palmitoyltrfase_DHHC

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01529, DHHC, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50216, DHHC, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5W0Z9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAPWTLWRCC QRVVGWVPVL FITFVVVWSY YAYVVELCVF TIFGNEENGK 
        60         70         80         90        100
TVVYLVAFHL FFVMFVWSYW MTIFTSPASP SKEFYLSNSE KERYEKEFSQ 
       110        120        130        140        150
ERQQEILRRA ARALPIYTTS ASKTIRYCEK CQLIKPDRAH HCSACDSCIL 
       160        170        180        190        200
KMDHHCPWVN NCVGFSNYKF FLLFLLYSLL YCLFVAATVL EYFIKFWTNE 
       210        220        230        240        250
LTDTRAKFHV LFLFFVSAMF FISVLSLFSY HCWLVGKNRT TIESFRAPTF 
       260        270        280        290        300
SYGPDGNGFS LGCSKNWRQV FGDEKKYWLL PIFSSLGDGC SFPTRLVGMD 
       310        320        330        340        350
PEQASVTNQN EYARSSGSNQ PFPIKPLSES KNRLLDSESQ WLENGAEEGI 
       360 
VKSGTNNHVT VAIEN
Length:365
Mass (Da):42,278
Last modified:December 7, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i179D8882138E4F53
GO
Isoform 2 (identifier: Q5W0Z9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     124-130: TIRYCEK → SLMQSTK
     131-365: Missing.

Show »
Length:130
Mass (Da):15,419
Checksum:iEF3F16905EED1A5D
GO
Isoform 3 (identifier: Q5W0Z9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     315-315: Missing.
     355-365: TNNHVTVAIEN → V

Show »
Length:354
Mass (Da):41,096
Checksum:i83CC11ECA4D38A17
GO
Isoform 4 (identifier: Q5W0Z9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     315-365: SSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGIVKSGTNNHVTVAIEN → RSKLQR

Show »
Length:320
Mass (Da):37,555
Checksum:i043D138E64899CB0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B4DRN8B4DRN8_HUMAN
Palmitoyltransferase
ZDHHC20
292Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0D9SEN4A0A0D9SEN4_HUMAN
Palmitoyltransferase ZDHHC20
ZDHHC20
19Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_016276124 – 130TIRYCEK → SLMQSTK in isoform 2. 1 Publication7
Alternative sequenceiVSP_016277131 – 365Missing in isoform 2. 1 PublicationAdd BLAST235
Alternative sequenceiVSP_056002315 – 365SSGSN…VAIEN → RSKLQR in isoform 4. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_040481315Missing in isoform 3. 1 Publication1
Alternative sequenceiVSP_040482355 – 365TNNHVTVAIEN → V in isoform 3. 1 PublicationAdd BLAST11

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AL136219 Genomic DNA No translation available.
CH471075 Genomic DNA Translation: EAX08309.1
BC034944 mRNA Translation: AAH34944.1
BC050367 mRNA Translation: AAH50367.2
BC067898 mRNA Translation: AAH67898.1
BC110517 mRNA Translation: AAI10518.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS45017.1 [Q5W0Z9-3]
CCDS81758.1 [Q5W0Z9-1]

NCBI Reference Sequences

More...RefSeqi		NP_001273567.1, NM_001286638.1
NP_001316988.1, NM_001330059.1 [Q5W0Z9-1]
NP_694983.2, NM_153251.3 [Q5W0Z9-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000320220; ENSP00000313583; ENSG00000180776 [Q5W0Z9-4]
ENST00000382466; ENSP00000371905; ENSG00000180776 [Q5W0Z9-3]
ENST00000400590; ENSP00000383433; ENSG00000180776
ENST00000415724; ENSP00000401232; ENSG00000180776

Database of genes from NCBI RefSeq genomes

More...GeneIDi		253832

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:253832

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000400590.8; ENSP00000383433.3; NM_001330059.2; NP_001316988.1

UCSC genome browser

More...UCSCi		uc001uoa.4, human [Q5W0Z9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136219 Genomic DNA No translation available.
CH471075 Genomic DNA Translation: EAX08309.1
BC034944 mRNA Translation: AAH34944.1
BC050367 mRNA Translation: AAH50367.2
BC067898 mRNA Translation: AAH67898.1
BC110517 mRNA Translation: AAI10518.1
CCDSiCCDS45017.1 [Q5W0Z9-3]
CCDS81758.1 [Q5W0Z9-1]
RefSeqiNP_001273567.1, NM_001286638.1
NP_001316988.1, NM_001330059.1 [Q5W0Z9-1]
NP_694983.2, NM_153251.3 [Q5W0Z9-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6BMLX-ray2.95A/B5-299[»]
6BMMX-ray2.35A/B7-299[»]
6BMNX-ray2.25A/B5-299[»]
SMRiQ5W0Z9
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi128991, 28 interactors
IntActiQ5W0Z9, 11 interactors
STRINGi9606.ENSP00000371905

Protein family/group databases

TCDBi8.A.114.1.6, the huntington-interacting protein 14 (hip14) family

PTM databases

iPTMnetiQ5W0Z9
PhosphoSitePlusiQ5W0Z9
SwissPalmiQ5W0Z9

Genetic variation databases

BioMutaiZDHHC20
DMDMi74748004

Proteomic databases

EPDiQ5W0Z9
jPOSTiQ5W0Z9
MassIVEiQ5W0Z9
MaxQBiQ5W0Z9
PaxDbiQ5W0Z9
PeptideAtlasiQ5W0Z9
PRIDEiQ5W0Z9
ProteomicsDBi61482
65788 [Q5W0Z9-1]
65789 [Q5W0Z9-2]
65790 [Q5W0Z9-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		4929, 194 antibodies from 24 providers

The DNASU plasmid repository

More...DNASUi		253832

Genome annotation databases

EnsembliENST00000320220; ENSP00000313583; ENSG00000180776 [Q5W0Z9-4]
ENST00000382466; ENSP00000371905; ENSG00000180776 [Q5W0Z9-3]
ENST00000400590; ENSP00000383433; ENSG00000180776
ENST00000415724; ENSP00000401232; ENSG00000180776
GeneIDi253832
KEGGihsa:253832
MANE-SelectiENST00000400590.8; ENSP00000383433.3; NM_001330059.2; NP_001316988.1
UCSCiuc001uoa.4, human [Q5W0Z9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		253832
DisGeNETi253832

GeneCards: human genes, protein and diseases

More...GeneCardsi		ZDHHC20
HGNCiHGNC:20749, ZDHHC20
HPAiENSG00000180776, Tissue enhanced (brain)
MIMi617972, gene
neXtProtiNX_Q5W0Z9
OpenTargetsiENSG00000180776
PharmGKBiPA134880838
VEuPathDBiHostDB:ENSG00000180776

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1315, Eukaryota
GeneTreeiENSGT00940000153716
InParanoidiQ5W0Z9
OMAiYLIFFHV
OrthoDBi1491968at2759
PhylomeDBiQ5W0Z9
TreeFamiTF316044

Enzyme and pathway databases

PathwayCommonsiQ5W0Z9
SignaLinkiQ5W0Z9

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		253832, 13 hits in 1046 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ZDHHC20, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		253832
PharosiQ5W0Z9, Tbio

Protein Ontology

More...PROi		PR:Q5W0Z9
RNActiQ5W0Z9, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000180776, Expressed in upper arm skin and 224 other tissues
ExpressionAtlasiQ5W0Z9, baseline and differential
GenevisibleiQ5W0Z9, HS

Family and domain databases

InterProiView protein in InterPro
IPR001594, Palmitoyltrfase_DHHC
PfamiView protein in Pfam
PF01529, DHHC, 1 hit
PROSITEiView protein in PROSITE
PS50216, DHHC, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZDH20_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5W0Z9
Secondary accession number(s): A8MTV9
, C9JG20, I6L9D4, Q2TB82, Q6NVU8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 22, 2005
Last sequence update: December 7, 2004
Last modified: February 23, 2022
This is version 144 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again