Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 131 (16 Oct 2019)
Sequence version 1 (07 Dec 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Palmitoyltransferase ZDHHC20

Gene

ZDHHC20

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes palmitoylation of Cys residues on target proteins (PubMed:27153536, PubMed:29326245). Catalyzes palmitoylation of Cys residues in the cytoplasmic C-terminus of EGFR, and modulates the duration of EGFR signaling by modulating palmitoylation-dependent EGFR internalization and degradation (PubMed:27153536). Has a preference for acyl-CoA with C16 fatty acid chains (PubMed:29326245). Can also utilize acyl-CoA with C14 and C18 fatty acid chains (PubMed:29326245).2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei29Important for selectivity toward medium-length fatty acids1 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi128Zinc 1Combined sources1 Publication1
Metal bindingi131Zinc 1Combined sources1 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei135Substrate1 Publication1
Metal bindingi141Zinc 1Combined sources1 Publication1
Metal bindingi142Zinc 2Combined sources1 Publication1
Metal bindingi145Zinc 2Combined sources1 Publication1
Metal bindingi148Zinc 1Combined sources1 Publication1
Metal bindingi155Zinc 2Combined sources1 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei156S-palmitoyl cysteine intermediate1 Publication1
Metal bindingi162Zinc 2Combined sources1 Publication1
Sitei181Important for selectivity toward medium-length fatty acids1 Publication1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionAcyltransferase, Transferase
LigandMetal-binding, Zinc

Protein family/group databases

Transport Classification Database

More...
TCDBi
8.A.114.1.6 the huntington-interacting protein 14 (hip14) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Palmitoyltransferase ZDHHC20 (EC:2.3.1.2252 Publications)
Alternative name(s):
Zinc finger DHHC domain-containing protein 20
Short name:
DHHC-20
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZDHHC20
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 13

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:20749 ZDHHC20

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
617972 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5W0Z9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 14Cytoplasmic1 PublicationAdd BLAST14
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei15 – 35Helical1 PublicationAdd BLAST21
Topological domaini36 – 53Lumenal1 PublicationAdd BLAST18
Transmembranei54 – 74Helical1 PublicationAdd BLAST21
Topological domaini75 – 169Cytoplasmic1 PublicationAdd BLAST95
Transmembranei170 – 190Helical1 PublicationAdd BLAST21
Topological domaini191 – 207Lumenal1 PublicationAdd BLAST17
Transmembranei208 – 231Helical1 PublicationAdd BLAST24
Topological domaini232 – 365Cytoplasmic1 PublicationAdd BLAST134

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi22I → W: Strongly reduced catalytic activity. 1 Publication1
Mutagenesisi29S → F: Strongly reduced catalytic activity. Enhances activity with acyl-CoA with C12 and C14 fatty acid chains. 1 Publication1
Mutagenesisi153D → A: Loss of catalytic activity. 1 Publication1
Mutagenesisi154H → A: Loss of catalytic activity. 1 Publication1
Mutagenesisi156C → S: Loss of catalytic activity. 1 Publication1
Mutagenesisi158W → A: Strongly reduced catalytic activity. 1 Publication1
Mutagenesisi171F → A: Loss of catalytic activity. 1 Publication1
Mutagenesisi174F → A: Strongly reduced catalytic activity. 1 Publication1
Mutagenesisi181Y → A: Moderately reduced catalytic activity. Enhances activity with acyl-CoA with C18 and C20 fatty acid chains. 1 Publication1
Mutagenesisi227L → W: Loss of catalytic activity. 1 Publication1
Mutagenesisi240 – 241TT → AA: Loss of catalytic activity. 1 Publication2
Mutagenesisi243E → A: Mildly reduced catalytic activity. 1 Publication1
Mutagenesisi266N → A: Strongly reduced catalytic activity. 1 Publication1
Mutagenesisi267Missing : Loss of catalytic activity. 1 Publication1
Mutagenesisi271F → A: Mildly reduced catalytic activity. 1 Publication1

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000180776

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134880838

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q5W0Z9

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZDHHC20

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74748004

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002129061 – 365Palmitoyltransferase ZDHHC20Add BLAST365

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei305PhosphoserineCombined sources1
Modified residuei330PhosphoserineCombined sources1
Modified residuei339PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Autopalmitoylated (in vitro).1 Publication

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q5W0Z9

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5W0Z9

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q5W0Z9

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q5W0Z9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5W0Z9

PeptideAtlas

More...
PeptideAtlasi
Q5W0Z9

PRoteomics IDEntifications database

More...
PRIDEi
Q5W0Z9

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
61482
65788 [Q5W0Z9-1]
65789 [Q5W0Z9-2]
65790 [Q5W0Z9-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5W0Z9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5W0Z9

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q5W0Z9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000180776 Expressed in 209 organ(s), highest expression level in corpus callosum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5W0Z9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5W0Z9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA014483
HPA014702

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
128991, 5 interactors

Protein interaction database and analysis system

More...
IntActi
Q5W0Z9, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000371905

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1365
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q5W0Z9

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini126 – 176DHHCPROSITE-ProRule annotationAdd BLAST51

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni140 – 143Substrate binding1 Publication4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The DHHC domain is required for palmitoyltransferase activity.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the DHHC palmitoyltransferase family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1315 Eukaryota
COG5273 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153716

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000234777

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5W0Z9

KEGG Orthology (KO)

More...
KOi
K20028

Identification of Orthologs from Complete Genome Data

More...
OMAi
IETFRAP

Database of Orthologous Groups

More...
OrthoDBi
1491968at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5W0Z9

TreeFam database of animal gene trees

More...
TreeFami
TF316044

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001594 Palmitoyltrfase_DHHC

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01529 DHHC, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50216 DHHC, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5W0Z9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAPWTLWRCC QRVVGWVPVL FITFVVVWSY YAYVVELCVF TIFGNEENGK
60 70 80 90 100
TVVYLVAFHL FFVMFVWSYW MTIFTSPASP SKEFYLSNSE KERYEKEFSQ
110 120 130 140 150
ERQQEILRRA ARALPIYTTS ASKTIRYCEK CQLIKPDRAH HCSACDSCIL
160 170 180 190 200
KMDHHCPWVN NCVGFSNYKF FLLFLLYSLL YCLFVAATVL EYFIKFWTNE
210 220 230 240 250
LTDTRAKFHV LFLFFVSAMF FISVLSLFSY HCWLVGKNRT TIESFRAPTF
260 270 280 290 300
SYGPDGNGFS LGCSKNWRQV FGDEKKYWLL PIFSSLGDGC SFPTRLVGMD
310 320 330 340 350
PEQASVTNQN EYARSSGSNQ PFPIKPLSES KNRLLDSESQ WLENGAEEGI
360
VKSGTNNHVT VAIEN
Length:365
Mass (Da):42,278
Last modified:December 7, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i179D8882138E4F53
GO
Isoform 2 (identifier: Q5W0Z9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     124-130: TIRYCEK → SLMQSTK
     131-365: Missing.

Note: No experimental confirmation available.
Show »
Length:130
Mass (Da):15,419
Checksum:iEF3F16905EED1A5D
GO
Isoform 3 (identifier: Q5W0Z9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     315-315: Missing.
     355-365: TNNHVTVAIEN → V

Show »
Length:354
Mass (Da):41,096
Checksum:i83CC11ECA4D38A17
GO
Isoform 4 (identifier: Q5W0Z9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     315-365: SSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGIVKSGTNNHVTVAIEN → RSKLQR

Note: No experimental confirmation available.
Show »
Length:320
Mass (Da):37,555
Checksum:i043D138E64899CB0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B4DRN8B4DRN8_HUMAN
Palmitoyltransferase
ZDHHC20
292Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0D9SEN4A0A0D9SEN4_HUMAN
Palmitoyltransferase ZDHHC20
ZDHHC20
19Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_016276124 – 130TIRYCEK → SLMQSTK in isoform 2. 1 Publication7
Alternative sequenceiVSP_016277131 – 365Missing in isoform 2. 1 PublicationAdd BLAST235
Alternative sequenceiVSP_056002315 – 365SSGSN…VAIEN → RSKLQR in isoform 4. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_040481315Missing in isoform 3. 1 Publication1
Alternative sequenceiVSP_040482355 – 365TNNHVTVAIEN → V in isoform 3. 1 PublicationAdd BLAST11

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AL136219 Genomic DNA No translation available.
CH471075 Genomic DNA Translation: EAX08309.1
BC034944 mRNA Translation: AAH34944.1
BC050367 mRNA Translation: AAH50367.2
BC067898 mRNA Translation: AAH67898.1
BC110517 mRNA Translation: AAI10518.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS45017.1 [Q5W0Z9-3]
CCDS81758.1 [Q5W0Z9-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001273567.1, NM_001286638.1
NP_001316988.1, NM_001330059.1 [Q5W0Z9-1]
NP_694983.2, NM_153251.3 [Q5W0Z9-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000320220; ENSP00000313583; ENSG00000180776 [Q5W0Z9-4]
ENST00000382466; ENSP00000371905; ENSG00000180776 [Q5W0Z9-3]
ENST00000400590; ENSP00000383433; ENSG00000180776 [Q5W0Z9-1]
ENST00000415724; ENSP00000401232; ENSG00000180776 [Q5W0Z9-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
253832

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:253832

UCSC genome browser

More...
UCSCi
uc001uoa.4 human [Q5W0Z9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136219 Genomic DNA No translation available.
CH471075 Genomic DNA Translation: EAX08309.1
BC034944 mRNA Translation: AAH34944.1
BC050367 mRNA Translation: AAH50367.2
BC067898 mRNA Translation: AAH67898.1
BC110517 mRNA Translation: AAI10518.1
CCDSiCCDS45017.1 [Q5W0Z9-3]
CCDS81758.1 [Q5W0Z9-1]
RefSeqiNP_001273567.1, NM_001286638.1
NP_001316988.1, NM_001330059.1 [Q5W0Z9-1]
NP_694983.2, NM_153251.3 [Q5W0Z9-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6BMLX-ray2.95A/B5-299[»]
6BMMX-ray2.35A/B7-299[»]
6BMNX-ray2.25A/B5-299[»]
SMRiQ5W0Z9
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi128991, 5 interactors
IntActiQ5W0Z9, 3 interactors
STRINGi9606.ENSP00000371905

Protein family/group databases

TCDBi8.A.114.1.6 the huntington-interacting protein 14 (hip14) family

PTM databases

iPTMnetiQ5W0Z9
PhosphoSitePlusiQ5W0Z9
SwissPalmiQ5W0Z9

Polymorphism and mutation databases

BioMutaiZDHHC20
DMDMi74748004

Proteomic databases

EPDiQ5W0Z9
jPOSTiQ5W0Z9
MassIVEiQ5W0Z9
MaxQBiQ5W0Z9
PaxDbiQ5W0Z9
PeptideAtlasiQ5W0Z9
PRIDEiQ5W0Z9
ProteomicsDBi61482
65788 [Q5W0Z9-1]
65789 [Q5W0Z9-2]
65790 [Q5W0Z9-3]

Genome annotation databases

EnsembliENST00000320220; ENSP00000313583; ENSG00000180776 [Q5W0Z9-4]
ENST00000382466; ENSP00000371905; ENSG00000180776 [Q5W0Z9-3]
ENST00000400590; ENSP00000383433; ENSG00000180776 [Q5W0Z9-1]
ENST00000415724; ENSP00000401232; ENSG00000180776 [Q5W0Z9-1]
GeneIDi253832
KEGGihsa:253832
UCSCiuc001uoa.4 human [Q5W0Z9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
253832

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZDHHC20
HGNCiHGNC:20749 ZDHHC20
HPAiHPA014483
HPA014702
MIMi617972 gene
neXtProtiNX_Q5W0Z9
OpenTargetsiENSG00000180776
PharmGKBiPA134880838

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1315 Eukaryota
COG5273 LUCA
GeneTreeiENSGT00940000153716
HOGENOMiHOG000234777
InParanoidiQ5W0Z9
KOiK20028
OMAiIETFRAP
OrthoDBi1491968at2759
PhylomeDBiQ5W0Z9
TreeFamiTF316044

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ZDHHC20 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
253832
PharosiQ5W0Z9

Protein Ontology

More...
PROi
PR:Q5W0Z9

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000180776 Expressed in 209 organ(s), highest expression level in corpus callosum
ExpressionAtlasiQ5W0Z9 baseline and differential
GenevisibleiQ5W0Z9 HS

Family and domain databases

InterProiView protein in InterPro
IPR001594 Palmitoyltrfase_DHHC
PfamiView protein in Pfam
PF01529 DHHC, 1 hit
PROSITEiView protein in PROSITE
PS50216 DHHC, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZDH20_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5W0Z9
Secondary accession number(s): A8MTV9
, C9JG20, I6L9D4, Q2TB82, Q6NVU8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 22, 2005
Last sequence update: December 7, 2004
Last modified: October 16, 2019
This is version 131 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again