Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 126 (17 Jun 2020)
Sequence version 2 (15 May 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Phospholipid phosphatase 4

Gene

PLPP4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Magnesium-independent phospholipid phosphatase with broad substrate specificity (PubMed:17590538). Preferentially catalyzes the conversion of diacylglycerol pyrophosphate into phosphatidate but can also act on phosphatidate and lysophosphatidate (PubMed:17590538). Phospholipid phosphatases are involved in both the synthesis of lipids and the degradation or generation of lipid-signaling molecules like diacylglycerol (PubMed:28851360).2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Magnesium-independent phospholipid phosphatase (PubMed:17590538). Inhibited by N-ethylmaleimide (PubMed:17590538).1 Publication

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=104 µM for 1,2-dioctanoyl-sn-glycero-3-diphosphate/diacylglycerol pyrophosphate1 Publication
  2. KM=506 µM for 1,2-dioctanoyl-sn-glycero-3-phosphate/phosphatidate1 Publication
  3. KM=580 µM for 1-(9Z-octadecenoyl)-sn-glycero-3-phosphate/lysophosphatidate1 Publication

    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: phospholipid metabolism

    This protein is involved in the pathway phospholipid metabolism, which is part of Lipid metabolism.1 Publication
    View all proteins of this organism that are known to be involved in the pathway phospholipid metabolism and in Lipid metabolism.

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei146Proton donorsBy similarity1
    Active sitei202NucleophileBy similarity1
    <p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei206Stabilizes the active site histidine for nucleophilic attackBy similarity1

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    GO - Biological processi

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionHydrolase
    Biological processLipid metabolism

    Enzyme and pathway databases

    BioCyc Collection of Pathway/Genome Databases

    More...
    BioCyci
    MetaCyc:G66-31698-MONOMER

    BRENDA Comprehensive Enzyme Information System

    More...
    BRENDAi
    3.1.3.4 2681
    3.1.3.81 2681

    Reactome - a knowledgebase of biological pathways and processes

    More...
    Reactomei
    R-HSA-2029485 Role of phospholipids in phagocytosis

    UniPathway: a resource for the exploration and annotation of metabolic pathways

    More...
    UniPathwayi
    UPA00085

    Chemistry databases

    SwissLipids knowledge resource for lipid biology

    More...
    SwissLipidsi
    SLP:000000605

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Phospholipid phosphatase 4Imported (EC:3.1.3.41 Publication, EC:3.1.3.811 Publication)
    Alternative name(s):
    Phosphatidic acid phosphatase type 2 domain-containing protein 1AImported
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:PLPP4Imported
    Synonyms:DPPL21 Publication, PPAPDC1Imported, PPAPDC1AImported
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

    Organism-specific databases

    Eukaryotic Pathogen Database Resources

    More...
    EuPathDBi
    HostDB:ENSG00000203805.10

    Human Gene Nomenclature Database

    More...
    HGNCi
    HGNC:23531 PLPP4

    neXtProt; the human protein knowledge platform

    More...
    neXtProti
    NX_Q5VZY2

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Topology

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei4 – 24HelicalSequence analysisAdd BLAST21
    Transmembranei49 – 69HelicalSequence analysisAdd BLAST21
    Transmembranei84 – 104HelicalSequence analysisAdd BLAST21
    Transmembranei142 – 162HelicalSequence analysisAdd BLAST21
    Transmembranei179 – 199HelicalSequence analysisAdd BLAST21
    Transmembranei202 – 222HelicalSequence analysisAdd BLAST21

    Keywords - Cellular componenti

    Membrane

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi109R → A: Loss of phosphatase activity; when associated with A-146 and with A-202. 1 Publication1
    Mutagenesisi146H → A: Loss of phosphatase activity; when associated with A-109 and with A-202. 1 Publication1
    Mutagenesisi202H → A: Loss of phosphatase activity; when associated with A-109 and with A-146. 1 Publication1

    Organism-specific databases

    DisGeNET

    More...
    DisGeNETi
    196051

    Open Targets

    More...
    OpenTargetsi
    ENSG00000203805

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...
    PharmGKBi
    PA134907381

    Miscellaneous databases

    Pharos NIH Druggable Genome Knowledgebase

    More...
    Pharosi
    Q5VZY2 Tbio

    Polymorphism and mutation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...
    BioMutai
    PLPP4

    Domain mapping of disease mutations (DMDM)

    More...
    DMDMi
    147721098

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002869431 – 271Phospholipid phosphatase 4Add BLAST271

    Proteomic databases

    jPOST - Japan Proteome Standard Repository/Database

    More...
    jPOSTi
    Q5VZY2

    MassIVE - Mass Spectrometry Interactive Virtual Environment

    More...
    MassIVEi
    Q5VZY2

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    Q5VZY2

    PeptideAtlas

    More...
    PeptideAtlasi
    Q5VZY2

    PRoteomics IDEntifications database

    More...
    PRIDEi
    Q5VZY2

    ProteomicsDB: a multi-organism proteome resource

    More...
    ProteomicsDBi
    65734 [Q5VZY2-1]
    65735 [Q5VZY2-2]
    65736 [Q5VZY2-3]
    65737 [Q5VZY2-4]

    PTM databases

    DEPOD human dephosphorylation database

    More...
    DEPODi
    Q5VZY2

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    Q5VZY2

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...
    PhosphoSitePlusi
    Q5VZY2

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Expressed mainly to the brain, kidney and testis, and to a lesser extent the bone marrow, thymus, prostate, liver and uterus.1 Publication

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...
    Bgeei
    ENSG00000203805 Expressed in hypothalamus and 117 other tissues

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    Q5VZY2 HS

    Organism-specific databases

    Human Protein Atlas

    More...
    HPAi
    ENSG00000203805 Tissue enhanced (brain, kidney)

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

    Hide details

    GO - Molecular functioni

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGRID)

    More...
    BioGRIDi
    128189, 3 interactors

    Protein interaction database and analysis system

    More...
    IntActi
    Q5VZY2, 32 interactors

    STRING: functional protein association networks

    More...
    STRINGi
    9606.ENSP00000381302

    Miscellaneous databases

    RNAct, Protein-RNA interaction predictions for model organisms.

    More...
    RNActi
    Q5VZY2 protein

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Region

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni102 – 110Phosphatase sequence motif I1 Publication9
    Regioni143 – 146Phosphatase sequence motif II1 Publication4
    Regioni195 – 205Phosphatase sequence motif III1 PublicationAdd BLAST11

    <p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    KOG3030 Eukaryota
    COG0671 LUCA

    Ensembl GeneTree

    More...
    GeneTreei
    ENSGT00940000158288

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    Q5VZY2

    KEGG Orthology (KO)

    More...
    KOi
    K18693

    Identification of Orthologs from Complete Genome Data

    More...
    OMAi
    ACHKSYV

    Database of Orthologous Groups

    More...
    OrthoDBi
    1621899at2759

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    Q5VZY2

    TreeFam database of animal gene trees

    More...
    TreeFami
    TF323722

    Family and domain databases

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR036938 P_Acid_Pase_2/haloperoxi_sf
    IPR000326 P_Acid_Pase_2/haloperoxidase
    IPR043216 PLPP
    IPR028668 PLPP4/5

    The PANTHER Classification System

    More...
    PANTHERi
    PTHR10165 PTHR10165, 1 hit
    PTHR10165:SF90 PTHR10165:SF90, 1 hit

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF01569 PAP2, 1 hit

    Simple Modular Architecture Research Tool; a protein domain database

    More...
    SMARTi
    View protein in SMART
    SM00014 acidPPc, 1 hit

    Superfamily database of structural and functional annotation

    More...
    SUPFAMi
    SSF48317 SSF48317, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
    Isoform 1 (identifier: Q5VZY2-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MRELAIEIGV RALLFGVFVF TEFLDPFQRV IQPEEIWLYK NPLVQSDNIP
    60 70 80 90 100
    TRLMFAISFL TPLAVICVVK IIRRTDKTEI KEAFLAVSLA LALNGVCTNT
    110 120 130 140 150
    IKLIVGRPRP DFFYRCFPDG VMNSEMHCTG DPDLVSEGRK SFPSIHSSFA
    160 170 180 190 200
    FSGLGFTTFY LAGKLHCFTE SGRGKSWRLC AAILPLYCAM MIALSRMCDY
    210 220 230 240 250
    KHHWQDSFVG GVIGLIFAYI CYRQHYPPLA NTACHKPYVS LRVPASLKKE
    260 270
    ERPTADSAPS LPLEGITEGP V
    Length:271
    Mass (Da):30,395
    Last modified:May 15, 2007 - v2
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC534549E44DDB9A1
    GO
    Isoform 2 (identifier: Q5VZY2-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         86-149: AVSLALALNGVCTNTIKLIVGRPRPDFFYRCFPDGVMNSEMHCTGDPDLVSEGRKSFPSIHSSF → V

    Show »
    Length:208
    Mass (Da):23,509
    Checksum:i9C4052029FE63D0F
    GO
    Isoform 3 (identifier: Q5VZY2-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-189: Missing.

    Show »
    Length:82
    Mass (Da):9,175
    Checksum:iA228474E1B007DBA
    GO
    Isoform 4 (identifier: Q5VZY2-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         56-96: AISFLTPLAV...VSLALALNGV → IPLWVESSAS...PTLVCESQPH
         97-271: Missing.

    Show »
    Length:96
    Mass (Da):11,089
    Checksum:iDE39DF5B00D26259
    GO

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0252371 – 189Missing in isoform 3. 1 PublicationAdd BLAST189
    Alternative sequenceiVSP_02523956 – 96AISFL…ALNGV → IPLWVESSASFLHTFATDST ILLWPTQLAINPTLVCESQP H in isoform 4. 1 PublicationAdd BLAST41
    Alternative sequenceiVSP_02523886 – 149AVSLA…IHSSF → V in isoform 2. 1 PublicationAdd BLAST64
    Alternative sequenceiVSP_02524097 – 271Missing in isoform 4. 1 PublicationAdd BLAST175

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    BD418666 mRNA No translation available.
    AC023282 Genomic DNA No translation available.
    AC073587 Genomic DNA No translation available.
    AL157782 Genomic DNA No translation available.
    BC101267 mRNA Translation: AAI01268.1
    BC101268 mRNA Translation: AAI01269.1
    BC101269 mRNA Translation: AAI01270.1
    BC122535 mRNA Translation: AAI22536.1
    BC132787 mRNA Translation: AAI32788.1

    The Consensus CDS (CCDS) project

    More...
    CCDSi
    CCDS41573.1 [Q5VZY2-1]

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_001025230.1, NM_001030059.2 [Q5VZY2-1]
    NP_001305095.1, NM_001318166.1
    NP_001305096.1, NM_001318167.1 [Q5VZY2-2]
    NP_001305097.1, NM_001318168.1
    NP_001305098.1, NM_001318169.1 [Q5VZY2-4]

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...
    Ensembli
    ENST00000398250; ENSP00000381302; ENSG00000203805 [Q5VZY2-1]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    196051

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    hsa:196051

    UCSC genome browser

    More...
    UCSCi
    uc001lev.1 human [Q5VZY2-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    BD418666 mRNA No translation available.
    AC023282 Genomic DNA No translation available.
    AC073587 Genomic DNA No translation available.
    AL157782 Genomic DNA No translation available.
    BC101267 mRNA Translation: AAI01268.1
    BC101268 mRNA Translation: AAI01269.1
    BC101269 mRNA Translation: AAI01270.1
    BC122535 mRNA Translation: AAI22536.1
    BC132787 mRNA Translation: AAI32788.1
    CCDSiCCDS41573.1 [Q5VZY2-1]
    RefSeqiNP_001025230.1, NM_001030059.2 [Q5VZY2-1]
    NP_001305095.1, NM_001318166.1
    NP_001305096.1, NM_001318167.1 [Q5VZY2-2]
    NP_001305097.1, NM_001318168.1
    NP_001305098.1, NM_001318169.1 [Q5VZY2-4]

    3D structure databases

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    SWISS-MODEL Interactive Workspace

    More...
    SWISS-MODEL-Workspacei
    Submit a new modelling project...

    Protein-protein interaction databases

    BioGRIDi128189, 3 interactors
    IntActiQ5VZY2, 32 interactors
    STRINGi9606.ENSP00000381302

    Chemistry databases

    SwissLipidsiSLP:000000605

    PTM databases

    DEPODiQ5VZY2
    iPTMnetiQ5VZY2
    PhosphoSitePlusiQ5VZY2

    Polymorphism and mutation databases

    BioMutaiPLPP4
    DMDMi147721098

    Proteomic databases

    jPOSTiQ5VZY2
    MassIVEiQ5VZY2
    PaxDbiQ5VZY2
    PeptideAtlasiQ5VZY2
    PRIDEiQ5VZY2
    ProteomicsDBi65734 [Q5VZY2-1]
    65735 [Q5VZY2-2]
    65736 [Q5VZY2-3]
    65737 [Q5VZY2-4]

    Protocols and materials databases

    Antibodypedia a portal for validated antibodies

    More...
    Antibodypediai
    46311 80 antibodies

    Genome annotation databases

    EnsembliENST00000398250; ENSP00000381302; ENSG00000203805 [Q5VZY2-1]
    GeneIDi196051
    KEGGihsa:196051
    UCSCiuc001lev.1 human [Q5VZY2-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...
    CTDi
    196051
    DisGeNETi196051
    EuPathDBiHostDB:ENSG00000203805.10

    GeneCards: human genes, protein and diseases

    More...
    GeneCardsi
    PLPP4
    HGNCiHGNC:23531 PLPP4
    HPAiENSG00000203805 Tissue enhanced (brain, kidney)
    neXtProtiNX_Q5VZY2
    OpenTargetsiENSG00000203805
    PharmGKBiPA134907381

    GenAtlas: human gene database

    More...
    GenAtlasi
    Search...

    Phylogenomic databases

    eggNOGiKOG3030 Eukaryota
    COG0671 LUCA
    GeneTreeiENSGT00940000158288
    InParanoidiQ5VZY2
    KOiK18693
    OMAiACHKSYV
    OrthoDBi1621899at2759
    PhylomeDBiQ5VZY2
    TreeFamiTF323722

    Enzyme and pathway databases

    UniPathwayiUPA00085
    BioCyciMetaCyc:G66-31698-MONOMER
    BRENDAi3.1.3.4 2681
    3.1.3.81 2681
    ReactomeiR-HSA-2029485 Role of phospholipids in phagocytosis

    Miscellaneous databases

    BioGRID ORCS database of CRISPR phenotype screens

    More...
    BioGRID-ORCSi
    196051 3 hits in 780 CRISPR screens

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...
    ChiTaRSi
    PLPP4 human

    The Gene Wiki collection of pages on human genes and proteins

    More...
    GeneWikii
    PPAPDC1A

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...
    GenomeRNAii
    196051
    PharosiQ5VZY2 Tbio

    Protein Ontology

    More...
    PROi
    PR:Q5VZY2
    RNActiQ5VZY2 protein

    Gene expression databases

    BgeeiENSG00000203805 Expressed in hypothalamus and 117 other tissues
    GenevisibleiQ5VZY2 HS

    Family and domain databases

    InterProiView protein in InterPro
    IPR036938 P_Acid_Pase_2/haloperoxi_sf
    IPR000326 P_Acid_Pase_2/haloperoxidase
    IPR043216 PLPP
    IPR028668 PLPP4/5
    PANTHERiPTHR10165 PTHR10165, 1 hit
    PTHR10165:SF90 PTHR10165:SF90, 1 hit
    PfamiView protein in Pfam
    PF01569 PAP2, 1 hit
    SMARTiView protein in SMART
    SM00014 acidPPc, 1 hit
    SUPFAMiSSF48317 SSF48317, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...
    ProtoNeti
    Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPLPP4_HUMAN
    <p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5VZY2
    Secondary accession number(s): A2RU82
    , Q08EQ2, Q0IIP2, Q495B4, Q5VZY1
    <p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 15, 2007
    Last sequence update: May 15, 2007
    Last modified: June 17, 2020
    This is version 126 of the entry and version 2 of the sequence. See complete history.
    <p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    Reference proteome

    Documents

    1. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    2. SIMILARITY comments
      Index of protein domains and families
    3. Human chromosome 10
      Human chromosome 10: entries, gene names and cross-references to MIM
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again