Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Phospholipid phosphatase 4

Gene

PLPP4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Displays magnesium-independent phosphatidate phosphatase activity in vitro. Catalyzes the conversion of phosphatidic acid to diacylglycerol.1 Publication

Catalytic activityi

A 1,2-diacylglycerol 3-phosphate + H2O = a 1,2-diacyl-sn-glycerol + phosphate.1 Publication

Activity regulationi

Inhibited by N-ethylmaleimide.1 Publication

Kineticsi

  1. KM=104 µM for diacylglycerol pyrophosphate1 Publication
  2. KM=506 µM for phosphatidate1 Publication
  3. KM=580 µM for lysophosphatidate1 Publication

    GO - Molecular functioni

    • identical protein binding Source: IntAct
    • phosphatidate phosphatase activity Source: UniProtKB

    GO - Biological processi

    Keywordsi

    Molecular functionHydrolase

    Enzyme and pathway databases

    BioCyciMetaCyc:G66-31698-MONOMER
    BRENDAi3.1.3.4 2681
    3.1.3.81 2681
    ReactomeiR-HSA-2029485 Role of phospholipids in phagocytosis

    Chemistry databases

    SwissLipidsiSLP:000000605

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Phospholipid phosphatase 4Imported (EC:3.1.3.4)
    Alternative name(s):
    Phosphatidic acid phosphatase type 2 domain-containing protein 1A
    Gene namesi
    Name:PLPP4Imported
    Synonyms:DPPL2, PPAPDC1, PPAPDC1A
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    Proteomesi
    • UP000005640 Componenti: Chromosome 10

    Organism-specific databases

    EuPathDBiHostDB:ENSG00000203805.10
    HGNCiHGNC:23531 PLPP4
    neXtProtiNX_Q5VZY2

    Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

    Topology

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Transmembranei4 – 24HelicalSequence analysisAdd BLAST21
    Transmembranei49 – 69HelicalSequence analysisAdd BLAST21
    Transmembranei84 – 104HelicalSequence analysisAdd BLAST21
    Transmembranei142 – 162HelicalSequence analysisAdd BLAST21
    Transmembranei179 – 199HelicalSequence analysisAdd BLAST21
    Transmembranei202 – 222HelicalSequence analysisAdd BLAST21

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Mutagenesisi109R → A: Loss of phosphatase activity; when associated with A-146 and with A-202. 1 Publication1
    Mutagenesisi146H → A: Loss of phosphatase activity; when associated with A-109 and with A-202. 1 Publication1
    Mutagenesisi202H → A: Loss of phosphatase activity; when associated with A-109 and with A-146. 1 Publication1

    Organism-specific databases

    DisGeNETi196051
    OpenTargetsiENSG00000203805
    PharmGKBiPA134907381

    Polymorphism and mutation databases

    BioMutaiPPAPDC1A
    DMDMi147721098

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    ChainiPRO_00002869431 – 271Phospholipid phosphatase 4Add BLAST271

    Proteomic databases

    PaxDbiQ5VZY2
    PeptideAtlasiQ5VZY2
    PRIDEiQ5VZY2
    ProteomicsDBi65734
    65735 [Q5VZY2-2]
    65736 [Q5VZY2-3]
    65737 [Q5VZY2-4]

    PTM databases

    DEPODiQ5VZY2
    iPTMnetiQ5VZY2
    PhosphoSitePlusiQ5VZY2

    Expressioni

    Tissue specificityi

    Expressed mainly to the brain, kidney and testis, and to a lesser extent the bone marrow, thymus, prostate, liver and uterus.1 Publication

    Gene expression databases

    BgeeiENSG00000203805 Expressed in 118 organ(s), highest expression level in hypothalamus
    CleanExiHS_PPAPDC1A
    ExpressionAtlasiQ5VZY2 baseline and differential
    GenevisibleiQ5VZY2 HS

    Organism-specific databases

    HPAiHPA045188

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    itself3EBI-10485931,EBI-10485931

    GO - Molecular functioni

    Protein-protein interaction databases

    BioGridi128189, 3 interactors
    IntActiQ5VZY2, 29 interactors
    STRINGi9606.ENSP00000381302

    Structurei

    3D structure databases

    ProteinModelPortaliQ5VZY2
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Regioni102 – 110Phosphatase sequence motif I9
    Regioni143 – 146Phosphatase sequence motif II4
    Regioni195 – 205Phosphatase sequence motif IIIAdd BLAST11

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiKOG3030 Eukaryota
    COG0671 LUCA
    GeneTreeiENSGT00510000046723
    HOGENOMiHOG000215098
    HOVERGENiHBG056764
    InParanoidiQ5VZY2
    KOiK18693
    OMAiIQYPFAV
    OrthoDBiEOG091G0O0I
    PhylomeDBiQ5VZY2
    TreeFamiTF323722

    Family and domain databases

    InterProiView protein in InterPro
    IPR036938 P_Acid_Pase_2/haloperoxi_sf
    IPR000326 P_Acid_Pase_2/haloperoxidase
    IPR028668 PLPP4
    PANTHERiPTHR10165:SF90 PTHR10165:SF90, 1 hit
    PfamiView protein in Pfam
    PF01569 PAP2, 1 hit
    SMARTiView protein in SMART
    SM00014 acidPPc, 1 hit
    SUPFAMiSSF48317 SSF48317, 1 hit

    Sequences (4+)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.iShow all

    Isoform 1 (identifier: Q5VZY2-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MRELAIEIGV RALLFGVFVF TEFLDPFQRV IQPEEIWLYK NPLVQSDNIP
    60 70 80 90 100
    TRLMFAISFL TPLAVICVVK IIRRTDKTEI KEAFLAVSLA LALNGVCTNT
    110 120 130 140 150
    IKLIVGRPRP DFFYRCFPDG VMNSEMHCTG DPDLVSEGRK SFPSIHSSFA
    160 170 180 190 200
    FSGLGFTTFY LAGKLHCFTE SGRGKSWRLC AAILPLYCAM MIALSRMCDY
    210 220 230 240 250
    KHHWQDSFVG GVIGLIFAYI CYRQHYPPLA NTACHKPYVS LRVPASLKKE
    260 270
    ERPTADSAPS LPLEGITEGP V
    Length:271
    Mass (Da):30,395
    Last modified:May 15, 2007 - v2
    Checksum:iC534549E44DDB9A1
    GO
    Isoform 2 (identifier: Q5VZY2-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         86-149: AVSLALALNGVCTNTIKLIVGRPRPDFFYRCFPDGVMNSEMHCTGDPDLVSEGRKSFPSIHSSF → V

    Note: No experimental confirmation available.
    Show »
    Length:208
    Mass (Da):23,509
    Checksum:i9C4052029FE63D0F
    GO
    Isoform 3 (identifier: Q5VZY2-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-189: Missing.

    Note: No experimental confirmation available.
    Show »
    Length:82
    Mass (Da):9,175
    Checksum:iA228474E1B007DBA
    GO
    Isoform 4 (identifier: Q5VZY2-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         56-96: AISFLTPLAV...VSLALALNGV → IPLWVESSAS...PTLVCESQPH
         97-271: Missing.

    Note: No experimental confirmation available.
    Show »
    Length:96
    Mass (Da):11,089
    Checksum:iDE39DF5B00D26259
    GO

    Computationally mapped potential isoform sequencesi

    There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    Gene namesLengthAnnotation
    X6R787X6R787_HUMAN
    Phospholipid phosphatase 4
    PLPP4
    261Annotation score:
    A0A0A0MSZ0A0A0A0MSZ0_HUMAN
    Phospholipid phosphatase 4
    PLPP4
    267Annotation score:

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Alternative sequenceiVSP_0252371 – 189Missing in isoform 3. 1 PublicationAdd BLAST189
    Alternative sequenceiVSP_02523956 – 96AISFL…ALNGV → IPLWVESSASFLHTFATDST ILLWPTQLAINPTLVCESQP H in isoform 4. 1 PublicationAdd BLAST41
    Alternative sequenceiVSP_02523886 – 149AVSLA…IHSSF → V in isoform 2. 1 PublicationAdd BLAST64
    Alternative sequenceiVSP_02524097 – 271Missing in isoform 4. 1 PublicationAdd BLAST175

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    BD418666 mRNA No translation available.
    AC023282 Genomic DNA No translation available.
    AC073587 Genomic DNA No translation available.
    AL157782 Genomic DNA No translation available.
    BC101267 mRNA Translation: AAI01268.1
    BC101268 mRNA Translation: AAI01269.1
    BC101269 mRNA Translation: AAI01270.1
    BC122535 mRNA Translation: AAI22536.1
    BC132787 mRNA Translation: AAI32788.1
    CCDSiCCDS41573.1 [Q5VZY2-1]
    RefSeqiNP_001025230.1, NM_001030059.2 [Q5VZY2-1]
    NP_001305095.1, NM_001318166.1
    NP_001305096.1, NM_001318167.1 [Q5VZY2-2]
    NP_001305097.1, NM_001318168.1
    NP_001305098.1, NM_001318169.1 [Q5VZY2-4]
    UniGeneiHs.40479

    Genome annotation databases

    EnsembliENST00000398250; ENSP00000381302; ENSG00000203805 [Q5VZY2-1]
    GeneIDi196051
    KEGGihsa:196051
    UCSCiuc001lev.1 human [Q5VZY2-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Similar proteinsi

    Entry informationi

    Entry nameiPLPP4_HUMAN
    AccessioniPrimary (citable) accession number: Q5VZY2
    Secondary accession number(s): A2RU82
    , Q08EQ2, Q0IIP2, Q495B4, Q5VZY1
    Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 15, 2007
    Last sequence update: May 15, 2007
    Last modified: September 12, 2018
    This is version 115 of the entry and version 2 of the sequence. See complete history.
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again