Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 109 (31 Jul 2019)
Sequence version 1 (07 Dec 2004)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Transmembrane protein 268

Gene

TMEM268

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transmembrane protein 268Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TMEM268Imported
Synonyms:C9orf91
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24513 TMEM268

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5VZI3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei105 – 125HelicalSequence analysisAdd BLAST21
Transmembranei132 – 152HelicalSequence analysisAdd BLAST21

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000157693

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134931542

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TMEM268

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74747808

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002794251 – 342Transmembrane protein 268Add BLAST342

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5VZI3

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q5VZI3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5VZI3

PeptideAtlas

More...
PeptideAtlasi
Q5VZI3

PRoteomics IDEntifications database

More...
PRIDEi
Q5VZI3

ProteomicsDB human proteome resource

More...
ProteomicsDBi
65698 [Q5VZI3-1]
65699 [Q5VZI3-2]
65700 [Q5VZI3-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5VZI3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5VZI3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000157693 Expressed in 197 organ(s), highest expression level in endothelial cell

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5VZI3 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA017199

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
128455, 5 interactors

Protein interaction database and analysis system

More...
IntActi
Q5VZI3, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000288502

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IH54 Eukaryota
ENOG4110XDR LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000011559

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5VZI3

Identification of Orthologs from Complete Genome Data

More...
OMAi
HTDSPRI

Database of Orthologous Groups

More...
OrthoDBi
868229at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5VZI3

TreeFam database of animal gene trees

More...
TreeFami
TF353168

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR028054 DUF4481

The PANTHER Classification System

More...
PANTHERi
PTHR31193 PTHR31193, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF14800 DUF4481, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q5VZI3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MACEPQVDPG ATGPLPPSSP GWSALPGGSP PGWGQELHNG QVLTVLRIDN
60 70 80 90 100
TCAPISFDLG AAEEQLQTWG IQVPADQYRS LAESALLEPQ VRRYIIYNSR
110 120 130 140 150
PMRLAFAVVF YVVVWANIYS TSQMFALGNH WAGMLLVTLA AVSLTLTLVL
160 170 180 190 200
VFERHQKKAN TNTDLRLAAA NGALLRHRVL LGVTDTVEGC QSVIQLWFVY
210 220 230 240 250
FDLENCVQFL SDHVQEMKTS QESLLRSRLS QLCVVMETGV SPATAEGPEN
260 270 280 290 300
LEDAPLLPGN SCPNERPLMQ TELHQLVPEA EPEEMARQLL AVFGGYYIRL
310 320 330 340
LVTSQLPQAM GTRHTNSPRI PCPCQLIEAY ILGTGCCPFL AR
Length:342
Mass (Da):37,569
Last modified:December 7, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i55900D3077B90A29
GO
Isoform 2 (identifier: Q5VZI3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MACEPQVDPGATGPLPPSSPGWSALPGGSPPGWGQ → MVITQPDEASGLLP

Note: No experimental confirmation available.
Show »
Length:321
Mass (Da):35,653
Checksum:i2D97DC0E20B80DC4
GO
Isoform 3 (identifier: Q5VZI3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-71: I → IQ

Show »
Length:343
Mass (Da):37,697
Checksum:iD00A44402FA04100
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC04537 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti59 – 62LGAA → PTRP in CAD39074 (PubMed:14702039).Curated4

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0234261 – 35MACEP…PGWGQ → MVITQPDEASGLLP in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_02342771I → IQ in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AL160275 Genomic DNA No translation available.
BX649023 mRNA No translation available.
BC019913 mRNA Translation: AAH19913.1
BC062550 mRNA Translation: AAH62550.1
BC107133 mRNA Translation: AAI07134.1
BC107134 mRNA Translation: AAI07135.1
AL834412 mRNA Translation: CAD39074.1
AK095364 mRNA Translation: BAC04537.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS6808.1 [Q5VZI3-1]
CCDS83405.1 [Q5VZI3-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001317689.1, NM_001330760.1 [Q5VZI3-3]
NP_694590.2, NM_153045.3 [Q5VZI3-1]
XP_011516657.1, XM_011518355.1 [Q5VZI3-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000288502; ENSP00000288502; ENSG00000157693 [Q5VZI3-1]
ENST00000374049; ENSP00000363161; ENSG00000157693 [Q5VZI3-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
203197

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:203197

UCSC genome browser

More...
UCSCi
uc004bjd.5 human [Q5VZI3-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL160275 Genomic DNA No translation available.
BX649023 mRNA No translation available.
BC019913 mRNA Translation: AAH19913.1
BC062550 mRNA Translation: AAH62550.1
BC107133 mRNA Translation: AAI07134.1
BC107134 mRNA Translation: AAI07135.1
AL834412 mRNA Translation: CAD39074.1
AK095364 mRNA Translation: BAC04537.1 Different initiation.
CCDSiCCDS6808.1 [Q5VZI3-1]
CCDS83405.1 [Q5VZI3-3]
RefSeqiNP_001317689.1, NM_001330760.1 [Q5VZI3-3]
NP_694590.2, NM_153045.3 [Q5VZI3-1]
XP_011516657.1, XM_011518355.1 [Q5VZI3-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi128455, 5 interactors
IntActiQ5VZI3, 1 interactor
STRINGi9606.ENSP00000288502

PTM databases

iPTMnetiQ5VZI3
PhosphoSitePlusiQ5VZI3

Polymorphism and mutation databases

BioMutaiTMEM268
DMDMi74747808

Proteomic databases

jPOSTiQ5VZI3
MaxQBiQ5VZI3
PaxDbiQ5VZI3
PeptideAtlasiQ5VZI3
PRIDEiQ5VZI3
ProteomicsDBi65698 [Q5VZI3-1]
65699 [Q5VZI3-2]
65700 [Q5VZI3-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
203197
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000288502; ENSP00000288502; ENSG00000157693 [Q5VZI3-1]
ENST00000374049; ENSP00000363161; ENSG00000157693 [Q5VZI3-3]
GeneIDi203197
KEGGihsa:203197
UCSCiuc004bjd.5 human [Q5VZI3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
203197

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TMEM268
HGNCiHGNC:24513 TMEM268
HPAiHPA017199
neXtProtiNX_Q5VZI3
OpenTargetsiENSG00000157693
PharmGKBiPA134931542

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IH54 Eukaryota
ENOG4110XDR LUCA
GeneTreeiENSGT00390000011559
InParanoidiQ5VZI3
OMAiHTDSPRI
OrthoDBi868229at2759
PhylomeDBiQ5VZI3
TreeFamiTF353168

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TMEM268 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
203197

Protein Ontology

More...
PROi
PR:Q5VZI3

Gene expression databases

BgeeiENSG00000157693 Expressed in 197 organ(s), highest expression level in endothelial cell
GenevisibleiQ5VZI3 HS

Family and domain databases

InterProiView protein in InterPro
IPR028054 DUF4481
PANTHERiPTHR31193 PTHR31193, 1 hit
PfamiView protein in Pfam
PF14800 DUF4481, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTM268_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5VZI3
Secondary accession number(s): A0PJA3
, Q3KNS4, Q5VZI2, Q6P5Z7, Q8N1P3, Q8ND43
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 6, 2007
Last sequence update: December 7, 2004
Last modified: July 31, 2019
This is version 109 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again