Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 112 (18 Sep 2019)
Sequence version 1 (07 Dec 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Mesenteric estrogen-dependent adipogenesis protein

Gene

MEDAG

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in processes that promote adipocyte differentiation, lipid accumulation, and glucose uptake in mature adipocytes.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Mesenteric estrogen-dependent adipogenesis protein
Alternative name(s):
Activated in W/Wv mouse stomach 3 homolog
Short name:
hAWMS3
Mesenteric estrogen-dependent adipose 4
Short name:
MEDA-4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MEDAG
Synonyms:AWMS3, C13orf33, MEDA4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 13

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25926 MEDAG

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5VYS4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
84935

Open Targets

More...
OpenTargetsi
ENSG00000102802

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA147358556

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MEDAG

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002743331 – 303Mesenteric estrogen-dependent adipogenesis proteinAdd BLAST303

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5VYS4

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q5VYS4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5VYS4

PeptideAtlas

More...
PeptideAtlasi
Q5VYS4

PRoteomics IDEntifications database

More...
PRIDEi
Q5VYS4

ProteomicsDB human proteome resource

More...
ProteomicsDBi
65640 [Q5VYS4-1]
65641 [Q5VYS4-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5VYS4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5VYS4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in the visceral fat depot.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000102802 Expressed in 171 organ(s), highest expression level in left coronary artery

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5VYS4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5VYS4 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q5VYS4, 5 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000369849

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IKGJ Eukaryota
ENOG411208I LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000018451

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000111804

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5VYS4

Identification of Orthologs from Complete Genome Data

More...
OMAi
MAGAACE

Database of Orthologous Groups

More...
OrthoDBi
1192582at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5VYS4

TreeFam database of animal gene trees

More...
TreeFami
TF328824

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR039230 MEDAG

The PANTHER Classification System

More...
PANTHERi
PTHR33769:SF3 PTHR33769:SF3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5VYS4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGAACEPVA RPSLTSISSG ELRSLWTCDC ELALLPLAQL LRLQPGAFQL
60 70 80 90 100
SGDQLVVARP GEPAAARGGF NVFGDGLVRL DGQLYRLSSY IKRYVELTNY
110 120 130 140 150
CDYKDYRETI LSKPMLFFIN VQTKKDTSKE RTYAFLVNTR HPKIRRQIEQ
160 170 180 190 200
GMDMVISSVI GESYRLQFDF QEAVKNFFPP GNEVVNGENL SFAYEFKADA
210 220 230 240 250
LFDFFYWFGL SNSVVKVNGK VLNLSSTSPE KKETIKLFLE KMSEPLIRRS
260 270 280 290 300
SFSDRKFSVT SRGSIDDVFN CNLSPRSSLT EPLLAELPFP SVLESEETPN

QFI
Length:303
Mass (Da):34,190
Last modified:December 7, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAAE14F897EA2C484
GO
Isoform 2 (identifier: Q5VYS4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-114: Missing.
     223-262: NLSSTSPEKKETIKLFLEKMSEPLIRRSSFSDRKFSVTSR → L

Show »
Length:150
Mass (Da):17,194
Checksum:i03DFF7F5C411C671
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0Y831H0Y831_HUMAN
Mesenteric estrogen-dependent adipo...
MEDAG
106Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03026159R → G2 PublicationsCorresponds to variant dbSNP:rs9531945Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0227141 – 114Missing in isoform 2. 1 PublicationAdd BLAST114
Alternative sequenceiVSP_022715223 – 262NLSST…SVTSR → L in isoform 2. 1 PublicationAdd BLAST40

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK027740 mRNA No translation available.
AK055635 mRNA Translation: BAB70975.1
AL353680 Genomic DNA No translation available.
BC040165 mRNA Translation: AAH40165.1
BC101624 mRNA Translation: AAI01625.1
BC101626 mRNA Translation: AAI01627.1
AB055407 mRNA Translation: BAC53805.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS9338.1 [Q5VYS4-1]

NCBI Reference Sequences

More...
RefSeqi
NP_116238.2, NM_032849.3 [Q5VYS4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000380482; ENSP00000369849; ENSG00000102802 [Q5VYS4-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84935

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84935

UCSC genome browser

More...
UCSCi
uc001uth.5 human [Q5VYS4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK027740 mRNA No translation available.
AK055635 mRNA Translation: BAB70975.1
AL353680 Genomic DNA No translation available.
BC040165 mRNA Translation: AAH40165.1
BC101624 mRNA Translation: AAI01625.1
BC101626 mRNA Translation: AAI01627.1
AB055407 mRNA Translation: BAC53805.1
CCDSiCCDS9338.1 [Q5VYS4-1]
RefSeqiNP_116238.2, NM_032849.3 [Q5VYS4-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

IntActiQ5VYS4, 5 interactors
STRINGi9606.ENSP00000369849

PTM databases

iPTMnetiQ5VYS4
PhosphoSitePlusiQ5VYS4

Polymorphism and mutation databases

BioMutaiMEDAG

Proteomic databases

jPOSTiQ5VYS4
MassIVEiQ5VYS4
PaxDbiQ5VYS4
PeptideAtlasiQ5VYS4
PRIDEiQ5VYS4
ProteomicsDBi65640 [Q5VYS4-1]
65641 [Q5VYS4-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
84935
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000380482; ENSP00000369849; ENSG00000102802 [Q5VYS4-1]
GeneIDi84935
KEGGihsa:84935
UCSCiuc001uth.5 human [Q5VYS4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84935
DisGeNETi84935

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MEDAG
HGNCiHGNC:25926 MEDAG
neXtProtiNX_Q5VYS4
OpenTargetsiENSG00000102802
PharmGKBiPA147358556

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IKGJ Eukaryota
ENOG411208I LUCA
GeneTreeiENSGT00390000018451
HOGENOMiHOG000111804
InParanoidiQ5VYS4
OMAiMAGAACE
OrthoDBi1192582at2759
PhylomeDBiQ5VYS4
TreeFamiTF328824

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84935

Pharos

More...
Pharosi
Q5VYS4

Protein Ontology

More...
PROi
PR:Q5VYS4

Gene expression databases

BgeeiENSG00000102802 Expressed in 171 organ(s), highest expression level in left coronary artery
ExpressionAtlasiQ5VYS4 baseline and differential
GenevisibleiQ5VYS4 HS

Family and domain databases

InterProiView protein in InterPro
IPR039230 MEDAG
PANTHERiPTHR33769:SF3 PTHR33769:SF3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMEDAG_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5VYS4
Secondary accession number(s): Q8IXF1, Q96K26, Q96NC8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: December 7, 2004
Last modified: September 18, 2019
This is version 112 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again