Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 105 (16 Oct 2019)
Sequence version 1 (07 Dec 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein shortage in chiasmata 1 ortholog

Gene

SHOC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

ATPase required during meiosis for the formation of crossover recombination intermediates (By similarity). Binds DNA: preferentially binds to single-stranded DNA and DNA branched structures (PubMed:29742103). Does not show nuclease activity in vitro, but shows ATPase activity, which is stimulated by the presence of single-stranded DNA (PubMed:29742103).By similarity1 Publication

Caution

Although related to the XPF family, the nuclease active site is not conserved.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Hydrolase
Biological processMeiosis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein shortage in chiasmata 1 orthologCurated (EC:3.6.-.-1 Publication)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SHOC11 PublicationImported
Synonyms:C9orf84Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26535 SHOC1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
618038 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5VXU9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Chromosome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
158401

Open Targets

More...
OpenTargetsi
ENSG00000165181

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134876692

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q5VXU9

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
C9orf84

Domain mapping of disease mutations (DMDM)

More...
DMDMi
71152416

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000897191 – 1444Protein shortage in chiasmata 1 orthologAdd BLAST1444

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q5VXU9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5VXU9

PeptideAtlas

More...
PeptideAtlasi
Q5VXU9

PRoteomics IDEntifications database

More...
PRIDEi
Q5VXU9

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
231
65615 [Q5VXU9-1]
65616 [Q5VXU9-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5VXU9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5VXU9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000165181 Expressed in 68 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5VXU9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5VXU9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA032108

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with TEX11.

1 Publication

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q5VXU9, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000363405

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the XPF family. Highly divergent.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IHV8 Eukaryota
ENOG41122IN LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000013037

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000230895

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5VXU9

Identification of Orthologs from Complete Genome Data

More...
OMAi
NHSFNLQ

Database of Orthologous Groups

More...
OrthoDBi
60413at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5VXU9

TreeFam database of animal gene trees

More...
TreeFami
TF338326

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR039991 SHOC1

The PANTHER Classification System

More...
PANTHERi
PTHR35668 PTHR35668, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF17825 DUF5587, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5VXU9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTDTSVLDQW KASFFVEDFL EKKTITRMVT QINCEFEEVV PSSNPDSQIE
60 70 80 90 100
VEEVSLYTHM DYNEVFTPVS CLEKCSALQN QNQDLFIDDK GILFVSSRKH
110 120 130 140 150
LPTLPTLLSR LKLFLVKDPL LDFKGQIFTE ANFSRECFSL QETLEAFVKE
160 170 180 190 200
DFCMDKVNFC QEKLEDTICL NEPSSFLIEY EFLIPPSLKP EIDIPSLSEL
210 220 230 240 250
KELLNPVPEI INYVDEKEKL FERDLTNKHG IEDIGDIKFS STEILTIQSQ
260 270 280 290 300
SEPEECSKPG ELEMPLTPLF LTCQHSSVNS LRTELQTFPL SPVCKINLLT
310 320 330 340 350
AEESANEYYM MWQLERCRSP LNPFLLTVPR IQEPHSQYSV TDLKKIFSVK
360 370 380 390 400
EESLVINLEK AEWWKQAGLN LKMMETLEHL NTYLCHDNLS SNDTKIEIFL
410 420 430 440 450
PTKVLQLESC LEHKSHSSPI ALIDEKSTNA HLSLPQKSPS LAKEVPDLCF
460 470 480 490 500
SDDYFSDKGA AKEEKPKNDQ EPVNRIIQKK ENNDHFELDC TGPSIKSPSS
510 520 530 540 550
SIIKKASFEH GKKQENDLDL LSDFIMLRNK YKTCTSKTEV TNSDEKHDKE
560 570 580 590 600
ACSLTLQEES PIVHINKTLE EINQERGTDS VIEIQASDSQ CQAFCLLEAA
610 620 630 640 650
ASPILKNLVS LCTLPTANWK FATVIFDQTR FLLKEQEKVV SDAVRQGTID
660 670 680 690 700
EREMTFKHAA LLHLLVTIRD VLLTCSLDTA LGYLSKAKDI YNSILGPYLG
710 720 730 740 750
DIWRQLEIVQ FIRGKKPETN YKIQELQCQI LSWMQSQQQI KVLIIIRMDS
760 770 780 790 800
DGEKHFLIKI LNKIEGLTLT VLHSNERKDF LESEGVLRGT SSCVVVHNQY
810 820 830 840 850
IGADFPWSNF SFVVEYNYVE DSCWTKHCKE LNIPYMAFKV ILPDTVLERS
860 870 880 890 900
TLLDRFGGFL LEIQIPYVFF ASEGLLNTPD ILQLLESNYN ISLVERGCSE
910 920 930 940 950
SLKLFGSSEC YVVVTIDEHT AIILQDLEEL NYEKASDNII MRLMALSLQY
960 970 980 990 1000
RYCWIILYTK ETLNSEYLLT EKTLHHLALI YAALVSFGLN SEELDVKLII
1010 1020 1030 1040 1050
APGVEATALI IRQIADHSLM TSKRDPHEWL DKSWLKVSPS EEEMYLLDFP
1060 1070 1080 1090 1100
CINPLVAQLM LNKGPSLHWI LLATLCQLQE LLPEVPEKVL KHFCSITSLF
1110 1120 1130 1140 1150
KIGSSSITKS PQISSPQENR NQISTLSSQS SASDLDSVIQ EHNEYYQYLG
1160 1170 1180 1190 1200
LGETVQEDKT TILNDNSSIM ELKEISSFLP PVTSYNQTSY WKDSSCKSNI
1210 1220 1230 1240 1250
GQNTPFLINI ESRRPAYNSF LNHSDSESDV FSLGLTQMNC ETIKSPTDTQ
1260 1270 1280 1290 1300
KRVSVVPRFI NSQKRRTHEA KGFINKDVSD PIFSLEGTQS PLHWNFKKNI
1310 1320 1330 1340 1350
WEQENHPFNL QYGAQQTACN KLYSQKGNLF TDQQKCLSDE SEGLTCESSK
1360 1370 1380 1390 1400
DETFWRELPS VPSLDLFRAS DSNANQKEFN SLYFYQRAGK SLGQKRHHES
1410 1420 1430 1440
SFNSGDKESL TGFMCSQLPQ FKKRRLAYEK VPGRVDGQTR LRFF
Note: Gene prediction confirmed by EST data.
Length:1,444
Mass (Da):165,202
Last modified:December 7, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1C442CBA253CF4A6
GO
Isoform 2 (identifier: Q5VXU9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MFSALKYHAIDYLYENVVRKKFYRDALLLRIPSCLYQDESYHVAVTDNKFRRPWTRVSAVSVPGM
     409-424: SCLEHKSHSSPIALID → CKYITVNISYVNIFRM
     425-1444: Missing.

Show »
Length:488
Mass (Da):56,742
Checksum:iE27ACFB2D7E54F9B
GO
Isoform 3 (identifier: Q5VXU9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-84: MTDTSVLDQW...CSALQNQNQD → MSETLGDELE...LRLRLAILKY

Note: No experimental confirmation available.
Show »
Length:1,405
Mass (Da):160,995
Checksum:i80DD0F4F11B3FE15
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A6PVK7A6PVK7_HUMAN
Protein shortage in chiasmata 1 ort...
SHOC1
1,370Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_050829226T → S. Corresponds to variant dbSNP:rs10981047Ensembl.1
Natural variantiVAR_050830416H → R. Corresponds to variant dbSNP:rs7470491Ensembl.1
Natural variantiVAR_050831649I → T. Corresponds to variant dbSNP:rs1322257Ensembl.1
Natural variantiVAR_050832734M → L. Corresponds to variant dbSNP:rs11791445Ensembl.1
Natural variantiVAR_050833788R → K. Corresponds to variant dbSNP:rs7868266Ensembl.1
Natural variantiVAR_050834809N → K. Corresponds to variant dbSNP:rs7036568Ensembl.1
Natural variantiVAR_050835932Y → C. Corresponds to variant dbSNP:rs1407390Ensembl.1
Natural variantiVAR_050836968L → P. Corresponds to variant dbSNP:rs6477845Ensembl.1
Natural variantiVAR_0508371162I → T. Corresponds to variant dbSNP:rs1475110Ensembl.1
Natural variantiVAR_0508381174E → G. Corresponds to variant dbSNP:rs7869279Ensembl.1
Natural variantiVAR_0508391380N → K. Corresponds to variant dbSNP:rs1322254Ensembl.1
Natural variantiVAR_0508401425R → C. Corresponds to variant dbSNP:rs10981009Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0466411 – 84MTDTS…NQNQD → MSETLGDELEILRGKMMQRR PRSAEVKYFYFFKILLRLRL AILKY in isoform 3. CuratedAdd BLAST84
Alternative sequenceiVSP_0147471M → MFSALKYHAIDYLYENVVRK KFYRDALLLRIPSCLYQDES YHVAVTDNKFRRPWTRVSAV SVPGM in isoform 2. 2 Publications1
Alternative sequenceiVSP_014748409 – 424SCLEH…IALID → CKYITVNISYVNIFRM in isoform 2. 2 PublicationsAdd BLAST16
Alternative sequenceiVSP_014749425 – 1444Missing in isoform 2. 2 PublicationsAdd BLAST1020

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK057341 mRNA Translation: BAB71436.1
AL135787 Genomic DNA No translation available.
AL356491 Genomic DNA No translation available.
AL354877 Genomic DNA No translation available.
BC112357 mRNA Translation: AAI12358.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43863.1 [Q5VXU9-3]
CCDS6781.3 [Q5VXU9-1]

NCBI Reference Sequences

More...
RefSeqi
XP_011516604.1, XM_011518302.2 [Q5VXU9-1]
XP_011516605.1, XM_011518303.1 [Q5VXU9-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000318737; ENSP00000322108; ENSG00000165181 [Q5VXU9-1]
ENST00000374283; ENSP00000363401; ENSG00000165181 [Q5VXU9-2]
ENST00000374287; ENSP00000363405; ENSG00000165181 [Q5VXU9-1]
ENST00000394779; ENSP00000378259; ENSG00000165181 [Q5VXU9-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
158401

UCSC genome browser

More...
UCSCi
uc004bfq.5 human [Q5VXU9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK057341 mRNA Translation: BAB71436.1
AL135787 Genomic DNA No translation available.
AL356491 Genomic DNA No translation available.
AL354877 Genomic DNA No translation available.
BC112357 mRNA Translation: AAI12358.1
CCDSiCCDS43863.1 [Q5VXU9-3]
CCDS6781.3 [Q5VXU9-1]
RefSeqiXP_011516604.1, XM_011518302.2 [Q5VXU9-1]
XP_011516605.1, XM_011518303.1 [Q5VXU9-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

IntActiQ5VXU9, 1 interactor
STRINGi9606.ENSP00000363405

PTM databases

iPTMnetiQ5VXU9
PhosphoSitePlusiQ5VXU9

Polymorphism and mutation databases

BioMutaiC9orf84
DMDMi71152416

Proteomic databases

MassIVEiQ5VXU9
PaxDbiQ5VXU9
PeptideAtlasiQ5VXU9
PRIDEiQ5VXU9
ProteomicsDBi231
65615 [Q5VXU9-1]
65616 [Q5VXU9-2]

Genome annotation databases

EnsembliENST00000318737; ENSP00000322108; ENSG00000165181 [Q5VXU9-1]
ENST00000374283; ENSP00000363401; ENSG00000165181 [Q5VXU9-2]
ENST00000374287; ENSP00000363405; ENSG00000165181 [Q5VXU9-1]
ENST00000394779; ENSP00000378259; ENSG00000165181 [Q5VXU9-3]
GeneIDi158401
UCSCiuc004bfq.5 human [Q5VXU9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
158401
DisGeNETi158401

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SHOC1
HGNCiHGNC:26535 SHOC1
HPAiHPA032108
MIMi618038 gene
neXtProtiNX_Q5VXU9
OpenTargetsiENSG00000165181
PharmGKBiPA134876692

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IHV8 Eukaryota
ENOG41122IN LUCA
GeneTreeiENSGT00390000013037
HOGENOMiHOG000230895
InParanoidiQ5VXU9
OMAiNHSFNLQ
OrthoDBi60413at2759
PhylomeDBiQ5VXU9
TreeFamiTF338326

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
C9orf84 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
158401
PharosiQ5VXU9

Protein Ontology

More...
PROi
PR:Q5VXU9

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000165181 Expressed in 68 organ(s), highest expression level in testis
ExpressionAtlasiQ5VXU9 baseline and differential
GenevisibleiQ5VXU9 HS

Family and domain databases

InterProiView protein in InterPro
IPR039991 SHOC1
PANTHERiPTHR35668 PTHR35668, 1 hit
PfamiView protein in Pfam
PF17825 DUF5587, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSHOC1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5VXU9
Secondary accession number(s): A2A2V3, Q2M1H8, Q96M73
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2005
Last sequence update: December 7, 2004
Last modified: October 16, 2019
This is version 105 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again