Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 2

Gene

NKAIN2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei91 – 92Breakpoint for interstitial deletion to form SUSP1-NKAIN22

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

  • regulation of sodium ion transport Source: GO_Central

Protein family/group databases

Transport Classification Database

More...
TCDBi
8.B.27.1.3 the na(+)k(+)-atpase beta-subunit interacting nkain (nkain) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 2
Short name:
Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 2
Alternative name(s):
Protein FAM77B
T-cell lymphoma breakpoint-associated target protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NKAIN2
Synonyms:FAM77B, TCBA1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000188580.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:16443 NKAIN2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609758 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5VXU1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei1 – 23HelicalSequence analysisAdd BLAST23
Transmembranei35 – 55HelicalSequence analysisAdd BLAST21
Transmembranei62 – 82HelicalSequence analysisAdd BLAST21
Transmembranei153 – 173HelicalSequence analysisAdd BLAST21

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

A chromosomal aberration involving NKAIN2 is a cause of lymphoma. Deletion del(6)(q13q21) within NKAIN2 and involving SUSP1 generates the SUSP1-NKAIN2 product (PubMed:11979551).1 Publication

Organism-specific databases

DisGeNET

More...
DisGeNETi
154215

Open Targets

More...
OpenTargetsi
ENSG00000188580

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162397563

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NKAIN2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74747583

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002650881 – 208Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 2Add BLAST208

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5VXU1

PeptideAtlas

More...
PeptideAtlasi
Q5VXU1

PRoteomics IDEntifications database

More...
PRIDEi
Q5VXU1

ProteomicsDB human proteome resource

More...
ProteomicsDBi
65610
65611 [Q5VXU1-2]
65612 [Q5VXU1-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5VXU1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5VXU1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in fetal brain. Weakly expressed in adult brain and thymus. Not expressed in any other normal tissue examined.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000188580 Expressed in 123 organ(s), highest expression level in frontal cortex

CleanEx database of gene expression profiles

More...
CleanExi
HS_NKAIN2

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5VXU1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5VXU1 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA045860

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with ATP1B1.By similarity

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000357402

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q5VXU1

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the NKAIN family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4556 Eukaryota
ENOG410XS8X LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160565

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000293382

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG108190

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5VXU1

KEGG Orthology (KO)

More...
KOi
K22735

Identification of Orthologs from Complete Genome Data

More...
OMAi
ACYVVKL

Database of Orthologous Groups

More...
OrthoDBi
1281511at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5VXU1

TreeFam database of animal gene trees

More...
TreeFami
TF321348

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR008516 Na/K-Atpase_Interacting

The PANTHER Classification System

More...
PANTHERi
PTHR13084 PTHR13084, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF05640 NKAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5VXU1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGYCSGRCTL IFICGMQLVC VLERQIFDFL GYQWAPILAN FVHIIIVILG
60 70 80 90 100
LFGTIQYRPR YITGYAVWLV LWVTWNVFVI CFYLEAGDLS KETDLILTFN
110 120 130 140 150
ISMHRSWWME NGPGCTVTSV TPAPDWAPED HRYITVSGCL LEYQYIEVAH
160 170 180 190 200
SSLQIVLALA GFIYACYVVK CITEEEDSFD FIGGFDSYGY QGPQKTSHLQ

LQPMYMSK
Length:208
Mass (Da):23,831
Last modified:December 7, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4877099BF4493A22
GO
Isoform 2 (identifier: Q5VXU1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     159-208: LAGFIYACYV...LQLQPMYMSK → VSVGSQPLLLVPLGLFYFCANSVHTNGICG

Note: No experimental confirmation available.
Show »
Length:188
Mass (Da):21,230
Checksum:i6E02A2397021DB01
GO
Isoform 3 (identifier: Q5VXU1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MGYCSGRCTLIFICGMQL → MGIIRFLLLYCPTNILT

Show »
Length:207
Mass (Da):23,816
Checksum:iBFCADCCFAE2861B8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5GY48F5GY48_HUMAN
Sodium/potassium-transporting ATPas...
NKAIN2
49Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2PRU3A0A1W2PRU3_HUMAN
Sodium/potassium-transporting ATPas...
NKAIN2
31Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0292981 – 18MGYCS…CGMQL → MGIIRFLLLYCPTNILT in isoform 3. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_021902159 – 208LAGFI…MYMSK → VSVGSQPLLLVPLGLFYFCA NSVHTNGICG in isoform 2. 1 PublicationAdd BLAST50

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB070452 mRNA Translation: BAB85477.1
AL354936 Genomic DNA No translation available.
AL356605 Genomic DNA No translation available.
AL121968 Genomic DNA No translation available.
AL136224 Genomic DNA No translation available.
BC035062 mRNA Translation: AAH35062.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34526.1 [Q5VXU1-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001035304.1, NM_001040214.2 [Q5VXU1-1]
NP_001287666.1, NM_001300737.1 [Q5VXU1-3]
NP_001287667.1, NM_001300738.1
NP_001287669.1, NM_001300740.1
NP_699186.2, NM_153355.4

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.656604

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000368416; ENSP00000357401; ENSG00000188580 [Q5VXU1-2]
ENST00000368417; ENSP00000357402; ENSG00000188580 [Q5VXU1-1]
ENST00000545433; ENSP00000437798; ENSG00000188580 [Q5VXU1-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
154215

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:154215

UCSC genome browser

More...
UCSCi
uc003pzn.2 human [Q5VXU1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB070452 mRNA Translation: BAB85477.1
AL354936 Genomic DNA No translation available.
AL356605 Genomic DNA No translation available.
AL121968 Genomic DNA No translation available.
AL136224 Genomic DNA No translation available.
BC035062 mRNA Translation: AAH35062.1
CCDSiCCDS34526.1 [Q5VXU1-1]
RefSeqiNP_001035304.1, NM_001040214.2 [Q5VXU1-1]
NP_001287666.1, NM_001300737.1 [Q5VXU1-3]
NP_001287667.1, NM_001300738.1
NP_001287669.1, NM_001300740.1
NP_699186.2, NM_153355.4
UniGeneiHs.656604

3D structure databases

ProteinModelPortaliQ5VXU1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000357402

Protein family/group databases

TCDBi8.B.27.1.3 the na(+)k(+)-atpase beta-subunit interacting nkain (nkain) family

PTM databases

iPTMnetiQ5VXU1
PhosphoSitePlusiQ5VXU1

Polymorphism and mutation databases

BioMutaiNKAIN2
DMDMi74747583

Proteomic databases

PaxDbiQ5VXU1
PeptideAtlasiQ5VXU1
PRIDEiQ5VXU1
ProteomicsDBi65610
65611 [Q5VXU1-2]
65612 [Q5VXU1-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000368416; ENSP00000357401; ENSG00000188580 [Q5VXU1-2]
ENST00000368417; ENSP00000357402; ENSG00000188580 [Q5VXU1-1]
ENST00000545433; ENSP00000437798; ENSG00000188580 [Q5VXU1-3]
GeneIDi154215
KEGGihsa:154215
UCSCiuc003pzn.2 human [Q5VXU1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
154215
DisGeNETi154215
EuPathDBiHostDB:ENSG00000188580.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NKAIN2
HGNCiHGNC:16443 NKAIN2
HPAiHPA045860
MIMi609758 gene
neXtProtiNX_Q5VXU1
OpenTargetsiENSG00000188580
PharmGKBiPA162397563

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4556 Eukaryota
ENOG410XS8X LUCA
GeneTreeiENSGT00940000160565
HOGENOMiHOG000293382
HOVERGENiHBG108190
InParanoidiQ5VXU1
KOiK22735
OMAiACYVVKL
OrthoDBi1281511at2759
PhylomeDBiQ5VXU1
TreeFamiTF321348

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NKAIN2 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
154215

Protein Ontology

More...
PROi
PR:Q5VXU1

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000188580 Expressed in 123 organ(s), highest expression level in frontal cortex
CleanExiHS_NKAIN2
ExpressionAtlasiQ5VXU1 baseline and differential
GenevisibleiQ5VXU1 HS

Family and domain databases

InterProiView protein in InterPro
IPR008516 Na/K-Atpase_Interacting
PANTHERiPTHR13084 PTHR13084, 1 hit
PfamiView protein in Pfam
PF05640 NKAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNKAI2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5VXU1
Secondary accession number(s): Q8IYR4, Q8TF67
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 12, 2006
Last sequence update: December 7, 2004
Last modified: January 16, 2019
This is version 112 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again