Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q5VUJ9 (DRC8_HUMAN)

Entry version 128 (02 Dec 2020)
Sequence version 1 (07 Dec 2004)
Previous versions | rss
Add a publicationFeedback
Protein

Dynein regulatory complex protein 8

Gene

EFCAB2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the nexin-dynein regulatory complex (N-DRC), a key regulator of ciliary/flagellar motility which maintains the alignment and integrity of the distal axoneme and regulates microtubule sliding in motile axonemes.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q5VUJ9

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Dynein regulatory complex protein 8By similarity
Alternative name(s):
EF-hand calcium-binding domain-containing protein 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:EFCAB2
Synonyms:DRC8By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000203666.12

Human Gene Nomenclature Database

More...HGNCi		HGNC:28166, EFCAB2

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q5VUJ9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Flagellum

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		84288

Open Targets

More...OpenTargetsi		ENSG00000203666

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA142671914

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q5VUJ9, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		EFCAB2

Domain mapping of disease mutations (DMDM)

More...DMDMi		74756857

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002535441 – 269Dynein regulatory complex protein 8Add BLAST269

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q5VUJ9

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q5VUJ9

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q5VUJ9

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q5VUJ9

PeptideAtlas

More...PeptideAtlasi		Q5VUJ9

PRoteomics IDEntifications database

More...PRIDEi		Q5VUJ9

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		65421 [Q5VUJ9-1]
65422 [Q5VUJ9-2]
65423 [Q5VUJ9-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q5VUJ9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q5VUJ9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000203666, Expressed in right uterine tube and 220 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q5VUJ9, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q5VUJ9, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000203666, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the nexin-dynein regulatory complex (N-DRC).

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		124015, 14 interactors

Protein interaction database and analysis system

More...IntActi		Q5VUJ9, 6 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000355480

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q5VUJ9, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q5VUJ9

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini150 – 185EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini228 – 263EF-hand 2PROSITE-ProRule annotationAdd BLAST36

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the DRC8 family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0027, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000160590

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_061288_19_2_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q5VUJ9

Database of Orthologous Groups

More...OrthoDBi		1226331at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q5VUJ9

TreeFam database of animal gene trees

More...TreeFami		TF324069

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR011992, EF-hand-dom_pair
IPR002048, EF_hand_dom

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00054, EFh, 2 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47473, SSF47473, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50222, EF_HAND_2, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5VUJ9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLGPGQVRLR PRVWRDKAGG RVADGASGLP PARGSWRETG TGRALGASSP 
        60         70         80         90        100
PRPAQGSSSP GIQSGPSSRP GSPRGAEQAG TPRPRLSLGI SQATGSAARW 
       110        120        130        140        150
RTRRTGKGLG YNSDEIRPRT LLIEHLMEGG RRDHHTMTVL WGTQEIIVAE 
       160        170        180        190        200
FHKKIKEAFE VFDHESNNTV DVREIGTIIR SLGCCPTEGE LHDLIAEVEE 
       210        220        230        240        250
EEPTGYIRFE KFLPVMTEIL LERKYRPIPE DVLLRAFEVL DSAKRGFLTK 
       260 
DELIKYMTEE DGVSLRRPG
Length:269
Mass (Da):29,714
Last modified:December 7, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFB123E7B09D12704
GO
Isoform 2 (identifier: Q5VUJ9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-136: Missing.
     137-144: MTVLWGTQ → MADEKDRE
     261-269: DGVSLRRPG → GEPFSQEEMEEMLSAAIDPESNSINYKDYITMMVIDEN

Show »
Length:162
Mass (Da):18,873
Checksum:i13E1A99F626DBFCA
GO
Isoform 3 (identifier: Q5VUJ9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-8: MLGPGQVR → MADEKDRE
     9-144: Missing.

Show »
Length:133
Mass (Da):15,458
Checksum:i765066883DEDDDB2
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BY53H7BY53_HUMAN
Dynein regulatory complex protein 8
EFCAB2
221Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y588H0Y588_HUMAN
Dynein regulatory complex protein 8
EFCAB2
52Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YHT5H0YHT5_HUMAN
Dynein regulatory complex protein 8
EFCAB2
131Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y6F0H0Y6F0_HUMAN
Dynein regulatory complex protein 8
EFCAB2
127Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti39T → A in AK090927 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0210551 – 136Missing in isoform 2. 1 PublicationAdd BLAST136
Alternative sequenceiVSP_0432731 – 8MLGPGQVR → MADEKDRE in isoform 3. 1 Publication8
Alternative sequenceiVSP_0432749 – 144Missing in isoform 3. 1 PublicationAdd BLAST136
Alternative sequenceiVSP_021056137 – 144MTVLWGTQ → MADEKDRE in isoform 2. 1 Publication8
Alternative sequenceiVSP_021057261 – 269DGVSLRRPG → GEPFSQEEMEEMLSAAIDPE SNSINYKDYITMMVIDEN in isoform 2. 1 Publication9

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK090927 mRNA No translation available.
AK302883 mRNA Translation: BAG64061.1
AL356512 Genomic DNA No translation available.
AL589763 Genomic DNA No translation available.
BC005357 mRNA Translation: AAH05357.1
AB209286 mRNA Translation: BAD92523.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS31082.1 [Q5VUJ9-2]
CCDS44341.1 [Q5VUJ9-3]

NCBI Reference Sequences

More...RefSeqi		NP_001137415.1, NM_001143943.1 [Q5VUJ9-3]
NP_115704.1, NM_032328.3 [Q5VUJ9-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000366522; ENSP00000355479; ENSG00000203666 [Q5VUJ9-1]
ENST00000366523; ENSP00000355480; ENSG00000203666 [Q5VUJ9-2]
ENST00000447569; ENSP00000408661; ENSG00000203666 [Q5VUJ9-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		84288

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:84288

UCSC genome browser

More...UCSCi		uc001ibc.3, human [Q5VUJ9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK090927 mRNA No translation available.
AK302883 mRNA Translation: BAG64061.1
AL356512 Genomic DNA No translation available.
AL589763 Genomic DNA No translation available.
BC005357 mRNA Translation: AAH05357.1
AB209286 mRNA Translation: BAD92523.1
CCDSiCCDS31082.1 [Q5VUJ9-2]
CCDS44341.1 [Q5VUJ9-3]
RefSeqiNP_001137415.1, NM_001143943.1 [Q5VUJ9-3]
NP_115704.1, NM_032328.3 [Q5VUJ9-2]

3D structure databases

SMRiQ5VUJ9
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi124015, 14 interactors
IntActiQ5VUJ9, 6 interactors
STRINGi9606.ENSP00000355480

PTM databases

iPTMnetiQ5VUJ9
PhosphoSitePlusiQ5VUJ9

Polymorphism and mutation databases

BioMutaiEFCAB2
DMDMi74756857

Proteomic databases

EPDiQ5VUJ9
jPOSTiQ5VUJ9
MassIVEiQ5VUJ9
PaxDbiQ5VUJ9
PeptideAtlasiQ5VUJ9
PRIDEiQ5VUJ9
ProteomicsDBi65421 [Q5VUJ9-1]
65422 [Q5VUJ9-2]
65423 [Q5VUJ9-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		34718, 26 antibodies

Genome annotation databases

EnsembliENST00000366522; ENSP00000355479; ENSG00000203666 [Q5VUJ9-1]
ENST00000366523; ENSP00000355480; ENSG00000203666 [Q5VUJ9-2]
ENST00000447569; ENSP00000408661; ENSG00000203666 [Q5VUJ9-3]
GeneIDi84288
KEGGihsa:84288
UCSCiuc001ibc.3, human [Q5VUJ9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		84288
DisGeNETi84288
EuPathDBiHostDB:ENSG00000203666.12

GeneCards: human genes, protein and diseases

More...GeneCardsi		EFCAB2
HGNCiHGNC:28166, EFCAB2
HPAiENSG00000203666, Low tissue specificity
neXtProtiNX_Q5VUJ9
OpenTargetsiENSG00000203666
PharmGKBiPA142671914

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0027, Eukaryota
GeneTreeiENSGT00940000160590
HOGENOMiCLU_061288_19_2_1
InParanoidiQ5VUJ9
OrthoDBi1226331at2759
PhylomeDBiQ5VUJ9
TreeFamiTF324069

Enzyme and pathway databases

PathwayCommonsiQ5VUJ9

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		84288, 6 hits in 842 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		EFCAB2, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		84288
PharosiQ5VUJ9, Tdark

Protein Ontology

More...PROi		PR:Q5VUJ9
RNActiQ5VUJ9, protein

Gene expression databases

BgeeiENSG00000203666, Expressed in right uterine tube and 220 other tissues
ExpressionAtlasiQ5VUJ9, baseline and differential
GenevisibleiQ5VUJ9, HS

Family and domain databases

InterProiView protein in InterPro
IPR011992, EF-hand-dom_pair
IPR002048, EF_hand_dom
SMARTiView protein in SMART
SM00054, EFh, 2 hits
SUPFAMiSSF47473, SSF47473, 1 hit
PROSITEiView protein in PROSITE
PS50222, EF_HAND_2, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDRC8_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5VUJ9
Secondary accession number(s): B4DZE9, Q59G23, Q9BS36
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 17, 2006
Last sequence update: December 7, 2004
Last modified: December 2, 2020
This is version 128 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again