Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 132 (17 Jun 2020)
Sequence version 1 (07 Dec 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Myomesin-3

Gene

MYOM3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May link the intermediate filament cytoskeleton to the M-disk of the myofibrils in striated muscle.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Myomesin-3
Alternative name(s):
Myomesin family member 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MYOM3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000142661.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26679 MYOM3

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5VTT5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
127294

Open Targets

More...
OpenTargetsi
ENSG00000142661

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134899390

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q5VTT5 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MYOM3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74762257

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003153941 – 1437Myomesin-3Add BLAST1437

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q5VTT5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5VTT5

PeptideAtlas

More...
PeptideAtlasi
Q5VTT5

PRoteomics IDEntifications database

More...
PRIDEi
Q5VTT5

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
65352 [Q5VTT5-1]
65353 [Q5VTT5-2]
65354 [Q5VTT5-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5VTT5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5VTT5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000142661 Expressed in gastrocnemius and 118 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5VTT5 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000142661 Group enriched (heart muscle, skeletal muscle, tongue)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
126050, 2 interactors

Protein interaction database and analysis system

More...
IntActi
Q5VTT5, 6 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000363557

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q5VTT5 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q5VTT5

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini154 – 246Ig-like C2-type 1Add BLAST93
Domaini269 – 361Ig-like C2-type 2Add BLAST93
Domaini375 – 469Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST95
Domaini503 – 598Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST96
Domaini604 – 696Fibronectin type-III 3PROSITE-ProRule annotationAdd BLAST93
Domaini702 – 797Fibronectin type-III 4PROSITE-ProRule annotationAdd BLAST96
Domaini804 – 899Fibronectin type-III 5PROSITE-ProRule annotationAdd BLAST96
Domaini1120 – 1205Ig-like C2-type 3Add BLAST86
Domaini1334 – 1423Ig-like C2-type 4Add BLAST90

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili120 – 149Sequence analysisAdd BLAST30

Keywords - Domaini

Coiled coil, Immunoglobulin domain, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IJ5G Eukaryota
ENOG410ZSRR LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158669

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_854026_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5VTT5

Identification of Orthologs from Complete Genome Data

More...
OMAi
GHFYQFR

Database of Orthologous Groups

More...
OrthoDBi
57219at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5VTT5

TreeFam database of animal gene trees

More...
TreeFami
TF331825

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00063 FN3, 5 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 12 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR013151 Immunoglobulin

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00041 fn3, 5 hits
PF07679 I-set, 3 hits
PF00047 ig, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00060 FN3, 5 hits
SM00409 IG, 5 hits
SM00408 IGc2, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726 SSF48726, 6 hits
SSF49265 SSF49265, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50853 FN3, 5 hits
PS50835 IG_LIKE, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q5VTT5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTLPHSLGGA GDPRPPQAME VHRLEHRQEE EQKEERQHSL RMGSSVRRRT
60 70 80 90 100
FRSSEEEHEF SAADYALAAA LALTASSELS WEAQLRRQTS AVELEERGQK
110 120 130 140 150
RVGFGNDWER TEIAFLQTHR LLRQRRDWKT LRRRTEEKVQ EAKELRELCY
160 170 180 190 200
GRGPWFWIPL RSHAVWEHTT VLLTCTVQAS PPPQVTWYKN DTRIDPRLFR
210 220 230 240 250
AGKYRITNNY GLLSLEIRRC AIEDSATYTV RVKNAHGQAS SFAKVLVRTY
260 270 280 290 300
LGKDAGFDSE IFKRSTFGPS VEFTSVLKPV FAREKEPFSL SCLFSEDVLD
310 320 330 340 350
AESIQWFRDG SLLRSSRRRK ILYTDRQASL KVSCTYKEDE GLYMVRVPSP
360 370 380 390 400
FGPREQSTYV LVRDAEAENP GAPGSPLNVR CLDVNRDCLI LTWAPPSDTR
410 420 430 440 450
GNPITAYTIE RCQGESGEWI ACHEAPGGTC RCPIQGLVEG QSYRFRVRAI
460 470 480 490 500
SRVGSSVPSK ASELVVMGDH DAARRKTEIP FDLGNKITIS TDAFEDTVTI
510 520 530 540 550
PSPPTNVHAS EIREAYVVLA WEEPSPRDRA PLTYSLEKSV IGSGTWEAIS
560 570 580 590 600
SESPVRSPRF AVLDLEKKKS YVFRVRAMNQ YGLSDPSEPS EPIALRGPPA
610 620 630 640 650
TLPPPAQVQA FRDTQTSVSL TWDPVKDPEL LGYYIYSRKV GTSEWQTVNN
660 670 680 690 700
KPIQGTRFTV PGLRTGKEYE FCVRSVSEAG VGESSAATEP IRVKQALATP
710 720 730 740 750
SAPYGFALLN CGKNEMVIGW KPPKRRGGGK ILGYFLDQHD SEELDWHAVN
760 770 780 790 800
QQPIPTRVCK VSDLHEGHFY EFRARAANWA GVGELSAPSS LFECKEWTMP
810 820 830 840 850
QPGPPYDVRA SEVRATSLVL QWEPPLYMGA GPVTGYHVSF QEEGSEQWKP
860 870 880 890 900
VTPGPISGTH LRVSDLQPGK SYVFQVQAMN SAGLGQPSMP TDPVLLEDKP
910 920 930 940 950
GAHEIEVGVD EEGFIYLAFE APEAPDSSEF QWSKDYKGPL DPQRVKIEDK
960 970 980 990 1000
VNKSKVILKE PGLEDLGTYS VIVTDADEDI SASHTLTEEE LEKLKKLSHE
1010 1020 1030 1040 1050
IRNPVIKLIS GWNIDILERG EVRLWLEVEK LSPAAELHLI FNNKEIFSSP
1060 1070 1080 1090 1100
NRKINFDREK GLVEVIIQNL SEEDKGSYTA QLQDGKAKNQ ITLTLVDDDF
1110 1120 1130 1140 1150
DKLLRKADAK RRDWKRKQGP YFERPLQWKV TEDCQVQLTC KVTNTKKETR
1160 1170 1180 1190 1200
FQWFFQRAEM PDGQYDPETG TGLLCIEELS KKDKGIYRAM VSDDRGEDDT
1210 1220 1230 1240 1250
ILDLTGDALD AIFTELGRIG ALSATPLKIQ GTEEGIRIFS KVKYYNVEYM
1260 1270 1280 1290 1300
KTTWFHKDKR LESGDRIRTG TTLDEIWLHI LDPKDSDKGK YTLEIAAGKE
1310 1320 1330 1340 1350
VRQLSTDLSG QAFEDAMAEH QRLKTLAIIE KNRAKVVRGL PDVATIMEDK
1360 1370 1380 1390 1400
TLCLTCIVSG DPTPEISWLK NDQPVTFLDR YRMEVRGTEV TITIEKVNSE
1410 1420 1430
DSGRYGVFVK NKYGSETGQV TISVFKHGDE PKELKSM
Length:1,437
Mass (Da):162,189
Last modified:December 7, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0025DEF2965AA001
GO
Isoform 2 (identifier: Q5VTT5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1179-1212: LSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAI → ASVAPASGLTFSFGCKPGRAKSSGLGVRAGPRLG
     1213-1437: Missing.

Show »
Length:1,212
Mass (Da):136,277
Checksum:i933DEC9AA0D4129A
GO
Isoform 3 (identifier: Q5VTT5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1107: Missing.
     1108-1141: DAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCK → MDISKKNRVRQGSRGRGKTISKNSESRGQQRRHM

Show »
Length:330
Mass (Da):37,475
Checksum:iEF25151C886E9780
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1083Q → R in BAC87343 (PubMed:14702039).Curated1
Sequence conflicti1246N → D in CAH10376 (PubMed:17974005).Curated1
Sequence conflicti1344A → T in CAH10376 (PubMed:17974005).Curated1
Sequence conflicti1350K → R in BAC04119 (PubMed:14702039).Curated1
Sequence conflicti1414G → V in BAC04119 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_049910258D → H1 PublicationCorresponds to variant dbSNP:rs4319261Ensembl.1
Natural variantiVAR_038179266T → M2 PublicationsCorresponds to variant dbSNP:rs6678540Ensembl.1
Natural variantiVAR_038180344M → T2 PublicationsCorresponds to variant dbSNP:rs4233050Ensembl.1
Natural variantiVAR_038181435Q → R1 PublicationCorresponds to variant dbSNP:rs6700245Ensembl.1
Natural variantiVAR_038182528D → G3 PublicationsCorresponds to variant dbSNP:rs4393101Ensembl.1
Natural variantiVAR_038183662G → R2 PublicationsCorresponds to variant dbSNP:rs4320729Ensembl.1
Natural variantiVAR_038184775R → Q. Corresponds to variant dbSNP:rs12082295Ensembl.1
Natural variantiVAR_038185853P → S1 PublicationCorresponds to variant dbSNP:rs35446243Ensembl.1
Natural variantiVAR_038186892D → A. Corresponds to variant dbSNP:rs36077733Ensembl.1
Natural variantiVAR_0381871041F → L. Corresponds to variant dbSNP:rs16829083Ensembl.1
Natural variantiVAR_0381881066I → T. Corresponds to variant dbSNP:rs12145360Ensembl.1
Natural variantiVAR_0381891124R → Q1 PublicationCorresponds to variant dbSNP:rs16829071Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0305421 – 1107Missing in isoform 3. 1 PublicationAdd BLAST1107
Alternative sequenceiVSP_0305431108 – 1141DAKRR…QLTCK → MDISKKNRVRQGSRGRGKTI SKNSESRGQQRRHM in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_0305441179 – 1212LSKKD…ALDAI → ASVAPASGLTFSFGCKPGRA KSSGLGVRAGPRLG in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_0305451213 – 1437Missing in isoform 2. 1 PublicationAdd BLAST225

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK093280 mRNA Translation: BAC04119.1
AK128233 mRNA Translation: BAC87343.1
AL591178 Genomic DNA No translation available.
CH471134 Genomic DNA Translation: EAW95108.1
BC014671 mRNA Translation: AAH14671.1
BC067101 mRNA Translation: AAH67101.1
BX537911 mRNA Translation: CAD97895.1
BX647453 mRNA Translation: CAH10377.1
BX647455 mRNA Translation: CAH10376.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41281.1 [Q5VTT5-1]

NCBI Reference Sequences

More...
RefSeqi
NP_689585.3, NM_152372.3 [Q5VTT5-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000338909; ENSP00000342689; ENSG00000142661 [Q5VTT5-3]
ENST00000374434; ENSP00000363557; ENSG00000142661 [Q5VTT5-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
127294

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:127294

UCSC genome browser

More...
UCSCi
uc001bil.5 human [Q5VTT5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK093280 mRNA Translation: BAC04119.1
AK128233 mRNA Translation: BAC87343.1
AL591178 Genomic DNA No translation available.
CH471134 Genomic DNA Translation: EAW95108.1
BC014671 mRNA Translation: AAH14671.1
BC067101 mRNA Translation: AAH67101.1
BX537911 mRNA Translation: CAD97895.1
BX647453 mRNA Translation: CAH10377.1
BX647455 mRNA Translation: CAH10376.1
CCDSiCCDS41281.1 [Q5VTT5-1]
RefSeqiNP_689585.3, NM_152372.3 [Q5VTT5-1]

3D structure databases

SMRiQ5VTT5
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi126050, 2 interactors
IntActiQ5VTT5, 6 interactors
STRINGi9606.ENSP00000363557

PTM databases

iPTMnetiQ5VTT5
PhosphoSitePlusiQ5VTT5

Polymorphism and mutation databases

BioMutaiMYOM3
DMDMi74762257

Proteomic databases

MassIVEiQ5VTT5
PaxDbiQ5VTT5
PeptideAtlasiQ5VTT5
PRIDEiQ5VTT5
ProteomicsDBi65352 [Q5VTT5-1]
65353 [Q5VTT5-2]
65354 [Q5VTT5-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
30256 61 antibodies

Genome annotation databases

EnsembliENST00000338909; ENSP00000342689; ENSG00000142661 [Q5VTT5-3]
ENST00000374434; ENSP00000363557; ENSG00000142661 [Q5VTT5-1]
GeneIDi127294
KEGGihsa:127294
UCSCiuc001bil.5 human [Q5VTT5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
127294
DisGeNETi127294
EuPathDBiHostDB:ENSG00000142661.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MYOM3
HGNCiHGNC:26679 MYOM3
HPAiENSG00000142661 Group enriched (heart muscle, skeletal muscle, tongue)
neXtProtiNX_Q5VTT5
OpenTargetsiENSG00000142661
PharmGKBiPA134899390

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IJ5G Eukaryota
ENOG410ZSRR LUCA
GeneTreeiENSGT00940000158669
HOGENOMiCLU_854026_0_0_1
InParanoidiQ5VTT5
OMAiGHFYQFR
OrthoDBi57219at2759
PhylomeDBiQ5VTT5
TreeFamiTF331825

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
127294 2 hits in 786 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
127294
PharosiQ5VTT5 Tdark

Protein Ontology

More...
PROi
PR:Q5VTT5
RNActiQ5VTT5 protein

Gene expression databases

BgeeiENSG00000142661 Expressed in gastrocnemius and 118 other tissues
GenevisibleiQ5VTT5 HS

Family and domain databases

CDDicd00063 FN3, 5 hits
Gene3Di2.60.40.10, 12 hits
InterProiView protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR013151 Immunoglobulin
PfamiView protein in Pfam
PF00041 fn3, 5 hits
PF07679 I-set, 3 hits
PF00047 ig, 1 hit
SMARTiView protein in SMART
SM00060 FN3, 5 hits
SM00409 IG, 5 hits
SM00408 IGc2, 3 hits
SUPFAMiSSF48726 SSF48726, 6 hits
SSF49265 SSF49265, 3 hits
PROSITEiView protein in PROSITE
PS50853 FN3, 5 hits
PS50835 IG_LIKE, 4 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMYOM3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5VTT5
Secondary accession number(s): A6NF75
, Q5VTT6, Q6AWC0, Q6AWC1, Q6NXF9, Q6ZRG7, Q7Z3G9, Q8NA11, Q96C54
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: December 7, 2004
Last modified: June 17, 2020
This is version 132 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again