Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Due to a server migration, the UniProt 'ID mapping', 'Peptide search' and 'community bibliography submission' tools will not be available on the 19th April 2021 during the morning (EST).
Entry version 137 (07 Apr 2021)
Sequence version 4 (18 Apr 2012)
Previous versions | rss
Add a publicationFeedback
Protein

Tetratricopeptide repeat protein 39B

Gene

TTC39B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulates high density lipoprotein (HDL) cholesterol metabolism by promoting the ubiquitination and degradation of the oxysterols receptors LXR (NR1H2 and NR1H3).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processLipid metabolism, Ubl conjugation pathway

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q5VTQ0

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tetratricopeptide repeat protein 39B
Short name:
TPR repeat protein 39B
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TTC39BImported
Synonyms:C9orf52
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:23704, TTC39B

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
613574, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5VTQ0

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000155158.20

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
158219

Open Targets

More...
OpenTargetsi
ENSG00000155158

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162407261

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q5VTQ0, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TTC39B

Domain mapping of disease mutations (DMDM)

More...
DMDMi
384872705

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002920001 – 682Tetratricopeptide repeat protein 39BAdd BLAST682

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5VTQ0

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q5VTQ0

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q5VTQ0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5VTQ0

PeptideAtlas

More...
PeptideAtlasi
Q5VTQ0

PRoteomics IDEntifications database

More...
PRIDEi
Q5VTQ0

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
65339 [Q5VTQ0-1]
65340 [Q5VTQ0-2]
65341 [Q5VTQ0-3]
65342 [Q5VTQ0-4]
65343 [Q5VTQ0-5]
65344 [Q5VTQ0-6]
65345 [Q5VTQ0-7]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5VTQ0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5VTQ0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000155158, Expressed in intestine and 199 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5VTQ0, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5VTQ0, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000155158, Tissue enhanced (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
127655, 8 interactors

Database of interacting proteins

More...
DIPi
DIP-62094N

Protein interaction database and analysis system

More...
IntActi
Q5VTQ0, 5 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000422496

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q5VTQ0, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q5VTQ0

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati393 – 426TPR 1Add BLAST34
Repeati626 – 659TPR 2Add BLAST34

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TTC39 family.Curated

Keywords - Domaini

Repeat, TPR repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3783, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182917

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_010086_3_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5VTQ0

Identification of Orthologs from Complete Genome Data

More...
OMAi
ELMYVWN

Database of Orthologous Groups

More...
OrthoDBi
754120at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5VTQ0

TreeFam database of animal gene trees

More...
TreeFami
TF313761

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR019412, Iml2/TPR_39
IPR019734, TPR_repeat
IPR034305, TTC39B

The PANTHER Classification System

More...
PANTHERi
PTHR31859, PTHR31859, 1 hit
PTHR31859:SF4, PTHR31859:SF4, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF10300, DUF3808, 1 hit
PF13174, TPR_6, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00028, TPR, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5VTQ0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDAVLACRLR GRGNRVAALR PRPRPGGSAG PSPFALLCAG LSPEPRAGVG
60 70 80 90 100
SEFPAWFLGG SSQRRNMALL GSRAELEADE DVFEDALETI SISSHSDMAT
110 120 130 140 150
SSLHFASCDT QQAPRQRGAS TVSSSSSTKV DLKSGLEECA VALNLFLSNK
160 170 180 190 200
FTDALELLRP WAKESMYHAL GYSTIVVLQA VLTFEQQDIQ NGISAMKDAL
210 220 230 240 250
QTCQKYRKKY TVVESFSSLL SRGSLEQLSE EEMHAEICYA ECLLQKAALT
260 270 280 290 300
FVQDENMINF IKGGLKIRTS YQIYKECLSI LHEIQKNKLQ QEFFYEFEGG
310 320 330 340 350
VKLGSGAFNL MLSLLPARII RLLEFIGFSG NRELGLLQLR EGASGRSMRS
360 370 380 390 400
ALCCLTILAF HTYISLILGT GEVNVAEAER LLAPFLQQFP NGSLVLFYHA
410 420 430 440 450
RIELLKGNLE EAQEVFQKCI SVQEEWKQFH HLCYWELMWI NVFQQNWMQA
460 470 480 490 500
YYYSDLLCKE SKWSKATYVF LKAAILSMLP EEDVVATNEN VVTLFRQVDS
510 520 530 540 550
LKQRIAGKSI PTEKFAVRKA RRYSASLPAP VKLILPALEM MYVWNGFSIV
560 570 580 590 600
SKRKDLSENL LVTVEKAEAA LQSQNFNSFS VDDECLVKLL KGCCLKNLQR
610 620 630 640 650
PLQAELCYNH VVESEKLLKY DHYLVPFTLF ELASLYKSQG EIDKAIKFLE
660 670 680
TARNNYKDYS LESRLHFRIQ AALHLWRKPS SD
Length:682
Mass (Da):76,956
Last modified:April 18, 2012 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6A61462D635A4373
GO
Isoform 2 (identifier: Q5VTQ0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-97: Missing.

Show »
Length:585
Mass (Da):66,766
Checksum:iC5D0C28D9362B082
GO
Isoform 3 (identifier: Q5VTQ0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     392-411: GSLVLFYHARIELLKGNLEE → VRSVFQS

Show »
Length:669
Mass (Da):75,476
Checksum:i009F5C3C3A954F81
GO
Isoform 4 (identifier: Q5VTQ0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     206-207: Missing.

Show »
Length:680
Mass (Da):76,636
Checksum:i43A01F3DE014B34F
GO
Isoform 5 (identifier: Q5VTQ0-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-165: Missing.

Show »
Length:517
Mass (Da):59,465
Checksum:iB25A5DD0B3FC9B4E
GO
Isoform 6 (identifier: Q5VTQ0-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     92-161: ISSHSDMATSSLHFASCDTQQAPRQRGASTVSSSSSTKVDLKSGLEECAVALNLFLSNKFTDALELLRPW → M

Show »
Length:613
Mass (Da):69,574
Checksum:iFACE3BD334D26630
GO
Isoform 7 (identifier: Q5VTQ0-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-483: Missing.
     484-495: VVATNENVVTLF → MTFLWGWAGVLH

Show »
Length:199
Mass (Da):22,955
Checksum:iF3A0DFA41D1518C1
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YAJ6H0YAJ6_HUMAN
Tetratricopeptide repeat protein 39...
TTC39B
69Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH42417 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence AAI42986 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAC03603 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAG60772 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti7C → Y in BAG61086 (PubMed:14702039).Curated1
Sequence conflicti329S → F in BAG61086 (PubMed:14702039).Curated1
Sequence conflicti496R → S in BAG60772 (PubMed:14702039).Curated1
Sequence conflicti500S → G in BAG60772 (PubMed:14702039).Curated1
Sequence conflicti667F → L in AAI42986 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_054078128T → P. Corresponds to variant dbSNP:rs10961917Ensembl.1
Natural variantiVAR_032926420I → V2 PublicationsCorresponds to variant dbSNP:rs1407977Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0427981 – 483Missing in isoform 7. 1 PublicationAdd BLAST483
Alternative sequenceiVSP_0427991 – 165Missing in isoform 5. 1 PublicationAdd BLAST165
Alternative sequenceiVSP_0263551 – 97Missing in isoform 2. 1 PublicationAdd BLAST97
Alternative sequenceiVSP_04280092 – 161ISSHS…LLRPW → M in isoform 6. 1 PublicationAdd BLAST70
Alternative sequenceiVSP_042801206 – 207Missing in isoform 4. 1 Publication2
Alternative sequenceiVSP_042802392 – 411GSLVL…GNLEE → VRSVFQS in isoform 3. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_042803484 – 495VVATN…VVTLF → MTFLWGWAGVLH in isoform 7. 1 PublicationAdd BLAST12

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK091187 mRNA Translation: BAC03603.1 Different initiation.
AK298581 mRNA Translation: BAG60772.1 Different initiation.
AK298998 mRNA Translation: BAG61086.1
AK301427 mRNA Translation: BAG62955.1
AL591393 Genomic DNA No translation available.
BC038592 mRNA Translation: AAH38592.1
BC042417 mRNA Translation: AAH42417.1 Different initiation.
BC142985 mRNA Translation: AAI42986.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS55294.1 [Q5VTQ0-5]
CCDS55295.1 [Q5VTQ0-6]
CCDS55296.1 [Q5VTQ0-3]
CCDS6477.2 [Q5VTQ0-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001161811.1, NM_001168339.1 [Q5VTQ0-4]
NP_001161812.1, NM_001168340.1 [Q5VTQ0-3]
NP_001161813.1, NM_001168341.1 [Q5VTQ0-6]
NP_001161814.1, NM_001168342.1 [Q5VTQ0-5]
NP_689787.2, NM_152574.2 [Q5VTQ0-1]
XP_011516034.1, XM_011517732.2 [Q5VTQ0-2]
XP_016869800.1, XM_017014311.1 [Q5VTQ0-2]
XP_016869801.1, XM_017014312.1 [Q5VTQ0-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000297615; ENSP00000297615; ENSG00000155158 [Q5VTQ0-6]
ENST00000380850; ENSP00000370231; ENSG00000155158 [Q5VTQ0-3]
ENST00000507285; ENSP00000426539; ENSG00000155158 [Q5VTQ0-5]
ENST00000507993; ENSP00000423392; ENSG00000155158 [Q5VTQ0-5]
ENST00000512701; ENSP00000422496; ENSG00000155158 [Q5VTQ0-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
158219

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:158219

UCSC genome browser

More...
UCSCi
uc003zlr.3, human [Q5VTQ0-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK091187 mRNA Translation: BAC03603.1 Different initiation.
AK298581 mRNA Translation: BAG60772.1 Different initiation.
AK298998 mRNA Translation: BAG61086.1
AK301427 mRNA Translation: BAG62955.1
AL591393 Genomic DNA No translation available.
BC038592 mRNA Translation: AAH38592.1
BC042417 mRNA Translation: AAH42417.1 Different initiation.
BC142985 mRNA Translation: AAI42986.1 Different initiation.
CCDSiCCDS55294.1 [Q5VTQ0-5]
CCDS55295.1 [Q5VTQ0-6]
CCDS55296.1 [Q5VTQ0-3]
CCDS6477.2 [Q5VTQ0-1]
RefSeqiNP_001161811.1, NM_001168339.1 [Q5VTQ0-4]
NP_001161812.1, NM_001168340.1 [Q5VTQ0-3]
NP_001161813.1, NM_001168341.1 [Q5VTQ0-6]
NP_001161814.1, NM_001168342.1 [Q5VTQ0-5]
NP_689787.2, NM_152574.2 [Q5VTQ0-1]
XP_011516034.1, XM_011517732.2 [Q5VTQ0-2]
XP_016869800.1, XM_017014311.1 [Q5VTQ0-2]
XP_016869801.1, XM_017014312.1 [Q5VTQ0-2]

3D structure databases

SMRiQ5VTQ0
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi127655, 8 interactors
DIPiDIP-62094N
IntActiQ5VTQ0, 5 interactors
STRINGi9606.ENSP00000422496

PTM databases

iPTMnetiQ5VTQ0
PhosphoSitePlusiQ5VTQ0

Genetic variation databases

BioMutaiTTC39B
DMDMi384872705

Proteomic databases

jPOSTiQ5VTQ0
MassIVEiQ5VTQ0
MaxQBiQ5VTQ0
PaxDbiQ5VTQ0
PeptideAtlasiQ5VTQ0
PRIDEiQ5VTQ0
ProteomicsDBi65339 [Q5VTQ0-1]
65340 [Q5VTQ0-2]
65341 [Q5VTQ0-3]
65342 [Q5VTQ0-4]
65343 [Q5VTQ0-5]
65344 [Q5VTQ0-6]
65345 [Q5VTQ0-7]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
24508, 96 antibodies

Genome annotation databases

EnsembliENST00000297615; ENSP00000297615; ENSG00000155158 [Q5VTQ0-6]
ENST00000380850; ENSP00000370231; ENSG00000155158 [Q5VTQ0-3]
ENST00000507285; ENSP00000426539; ENSG00000155158 [Q5VTQ0-5]
ENST00000507993; ENSP00000423392; ENSG00000155158 [Q5VTQ0-5]
ENST00000512701; ENSP00000422496; ENSG00000155158 [Q5VTQ0-1]
GeneIDi158219
KEGGihsa:158219
UCSCiuc003zlr.3, human [Q5VTQ0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
158219
DisGeNETi158219

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TTC39B
HGNCiHGNC:23704, TTC39B
HPAiENSG00000155158, Tissue enhanced (brain)
MIMi613574, gene
neXtProtiNX_Q5VTQ0
OpenTargetsiENSG00000155158
PharmGKBiPA162407261
VEuPathDBiHostDB:ENSG00000155158.20

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3783, Eukaryota
GeneTreeiENSGT00950000182917
HOGENOMiCLU_010086_3_0_1
InParanoidiQ5VTQ0
OMAiELMYVWN
OrthoDBi754120at2759
PhylomeDBiQ5VTQ0
TreeFamiTF313761

Enzyme and pathway databases

PathwayCommonsiQ5VTQ0

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
158219, 4 hits in 991 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TTC39B, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
158219
PharosiQ5VTQ0, Tbio

Protein Ontology

More...
PROi
PR:Q5VTQ0
RNActiQ5VTQ0, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000155158, Expressed in intestine and 199 other tissues
ExpressionAtlasiQ5VTQ0, baseline and differential
GenevisibleiQ5VTQ0, HS

Family and domain databases

InterProiView protein in InterPro
IPR019412, Iml2/TPR_39
IPR019734, TPR_repeat
IPR034305, TTC39B
PANTHERiPTHR31859, PTHR31859, 1 hit
PTHR31859:SF4, PTHR31859:SF4, 1 hit
PfamiView protein in Pfam
PF10300, DUF3808, 1 hit
PF13174, TPR_6, 1 hit
SMARTiView protein in SMART
SM00028, TPR, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTT39B_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5VTQ0
Secondary accession number(s): A5PLN1
, B4DQ10, B4DQX4, B4DW93, Q8IVR7, Q8IXZ6, Q8N267
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 26, 2007
Last sequence update: April 18, 2012
Last modified: April 7, 2021
This is version 137 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again