Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 9

Gene

AGAP9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Protein inferred from homologyi <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Putative GTPase-activating protein.Curated

Miscellaneous

Encoded by one of the numerous copies of centaurin gamma-like genes clustered in the q11 region of chromosome 10.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri524 – 547C4-typePROSITE-ProRule annotationAdd BLAST24

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGTPase activation
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 9
Short name:
AGAP-9
Alternative name(s):
Centaurin-gamma-like family member 6
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:AGAP9
Synonyms:CTGLF6
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000204172.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:23463 AGAP9

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5VTM2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000204172

Polymorphism and mutation databases

Domain mapping of disease mutations (DMDM)

More...
DMDMi
145558891

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002846771 – 703Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 9Add BLAST703

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5VTM2

PeptideAtlas

More...
PeptideAtlasi
Q5VTM2

PRoteomics IDEntifications database

More...
PRIDEi
Q5VTM2

ProteomicsDB human proteome resource

More...
ProteomicsDBi
65337

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5VTM2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5VTM2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000204172 Expressed in 90 organ(s), highest expression level in body of pancreas

CleanEx database of gene expression profiles

More...
CleanExi
HS_AGAP9

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5VTM2 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA042490

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q5VTM2, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000407436

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q5VTM2

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q5VTM2

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini327 – 488PHPROSITE-ProRule annotationAdd BLAST162
Domaini509 – 629Arf-GAPPROSITE-ProRule annotationAdd BLAST121
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati631 – 700ANKAdd BLAST70

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the centaurin gamma-like family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri524 – 547C4-typePROSITE-ProRule annotationAdd BLAST24

Keywords - Domaini

ANK repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0705 Eukaryota
KOG1951 Eukaryota
COG5192 LUCA
COG5347 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000163475

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000007233

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG054045

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5VTM2

Identification of Orthologs from Complete Genome Data

More...
OMAi
KEWWIRS

Database of Orthologous Groups

More...
OrthoDBi
EOG091G123A

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5VTM2

TreeFam database of animal gene trees

More...
TreeFami
TF317762

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.20, 1 hit
3.30.40.160, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR037278 ARFGAP/RecO
IPR001164 ArfGAP_dom
IPR038508 ArfGAP_dom_sf
IPR027417 P-loop_NTPase
IPR001849 PH_domain

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01412 ArfGap, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00405 REVINTRACTNG

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00105 ArfGap, 1 hit
SM00233 PH, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540 SSF52540, 1 hit
SSF57863 SSF57863, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50115 ARFGAP, 1 hit
PS50003 PH_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q5VTM2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFEDVFSDSG NTGNFDRGKK RRLTIIECGC DINMMIDLAK VADLVLMLID
60 70 80 90 100
ASFGFEMEMF EFLNICQAHG FPKILGVLTH LDSFKHNKQL KKTKKRLKHR
110 120 130 140 150
FWTEVYQDKV GLTHELVQSL ISTYSTIDAK MASSRVTLLS NSKPLGSEAI
160 170 180 190 200
DNQGVSLEFD QQQGSVCPSE SEIYEAGAED RMAGAPMAAA VQPAEVTVEV
210 220 230 240 250
GEDLHMHQVR DREMPEVVEI RRSNCTNHCD LGDTSSYHTK VSTVHIMKKR
260 270 280 290 300
NGGGSLNNYS SSIPPTPSTS QEDPQFSVPP TANTPTPVCK RSMRWSNLFT
310 320 330 340 350
SEKGSDPDKE RKAPENHADT IGSGRAIPIK QGMLLKRSGK WLKTWKKKYV
360 370 380 390 400
TLCSNGVLTY YSSLGDYMKN IHKKEIDLRT STIKVPGKWP SLATSACAPI
410 420 430 440 450
SSSKSNGLSK DMDTGLGDSI CFSPGISSTT SPKLNPPPSP HANKKKHLKK
460 470 480 490 500
KSTNNFMIVS ATGQTWHFEA TTYEERDAWV QAIQSQILAS LQSCKSSKSK
510 520 530 540 550
SQLTSQSEAM ALQSIQNMRG NAHCVDCETQ NPKWASLNLG VLMCIECSGI
560 570 580 590 600
HRSFGTRLSR VRSLELDDWP VELRKVMSSI GNELANSIWE GSSQGQTKPS
610 620 630 640 650
IKSTREEKEW WIRSKYEEKL FLAPLPCTEL SLGQQLLRAT TDEDLQTAIL
660 670 680 690 700
LLAHGSREEV NETCGEGDGC TALHLACRKG NVVLEQLLTG WTSWPEMPTG

TQR
Length:703
Mass (Da):77,972
Last modified:April 17, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i28D84F589E15A0EB
GO
Isoform 2 (identifier: Q5VTM2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-154: MFEDVFSDSG...LGSEAIDNQG → MGNILTCRVHPS
     216-216: E → EALEFNLSANPEASTIFQRNSQTDALEFNSSANPEASTIFQRNSQTD
     229-240: CDLGDTSSYHTK → VSTERFSQQYSSCSTIFLDDSTAIQHYLTMTIISVTLEIPHHITQRDADRSLSIPDEQLHSFA

Note: No experimental confirmation available.
Show »
Length:658
Mass (Da):72,750
Checksum:iCEA1E89921371BA5
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti495K → E in BC171845 (PubMed:15489334).Curated1
Sequence conflicti508E → K in BC171845 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0445491 – 154MFEDV…IDNQG → MGNILTCRVHPS in isoform 2. 1 PublicationAdd BLAST154
Alternative sequenceiVSP_044550216E → EALEFNLSANPEASTIFQRN SQTDALEFNSSANPEASTIF QRNSQTD in isoform 2. 1 Publication1
Alternative sequenceiVSP_044551229 – 240CDLGD…SYHTK → VSTERFSQQYSSCSTIFLDD STAIQHYLTMTIISVTLEIP HHITQRDADRSLSIPDEQLH SFA in isoform 2. 1 PublicationAdd BLAST12

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AL591684 Genomic DNA No translation available.
BC171845 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS73125.1 [Q5VTM2-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001177739.1, NM_001190810.1 [Q5VTM2-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.645346
Hs.742298

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000452145; ENSP00000392206; ENSG00000204172 [Q5VTM2-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
642517

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:642517

UCSC genome browser

More...
UCSCi
uc057tbu.1 human [Q5VTM2-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL591684 Genomic DNA No translation available.
BC171845 Genomic DNA No translation available.
CCDSiCCDS73125.1 [Q5VTM2-2]
RefSeqiNP_001177739.1, NM_001190810.1 [Q5VTM2-2]
UniGeneiHs.645346
Hs.742298

3D structure databases

ProteinModelPortaliQ5VTM2
SMRiQ5VTM2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ5VTM2, 1 interactor
STRINGi9606.ENSP00000407436

PTM databases

iPTMnetiQ5VTM2
PhosphoSitePlusiQ5VTM2

Polymorphism and mutation databases

DMDMi145558891

Proteomic databases

PaxDbiQ5VTM2
PeptideAtlasiQ5VTM2
PRIDEiQ5VTM2
ProteomicsDBi65337

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000452145; ENSP00000392206; ENSG00000204172 [Q5VTM2-2]
GeneIDi642517
KEGGihsa:642517
UCSCiuc057tbu.1 human [Q5VTM2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
642517
EuPathDBiHostDB:ENSG00000204172.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
AGAP9
HGNCiHGNC:23463 AGAP9
HPAiHPA042490
neXtProtiNX_Q5VTM2
OpenTargetsiENSG00000204172

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0705 Eukaryota
KOG1951 Eukaryota
COG5192 LUCA
COG5347 LUCA
GeneTreeiENSGT00940000163475
HOGENOMiHOG000007233
HOVERGENiHBG054045
InParanoidiQ5VTM2
OMAiKEWWIRS
OrthoDBiEOG091G123A
PhylomeDBiQ5VTM2
TreeFamiTF317762

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
AGAP9 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
642517

Protein Ontology

More...
PROi
PR:Q5VTM2

Gene expression databases

BgeeiENSG00000204172 Expressed in 90 organ(s), highest expression level in body of pancreas
CleanExiHS_AGAP9
GenevisibleiQ5VTM2 HS

Family and domain databases

Gene3Di1.25.40.20, 1 hit
3.30.40.160, 1 hit
InterProiView protein in InterPro
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR037278 ARFGAP/RecO
IPR001164 ArfGAP_dom
IPR038508 ArfGAP_dom_sf
IPR027417 P-loop_NTPase
IPR001849 PH_domain
PfamiView protein in Pfam
PF01412 ArfGap, 1 hit
PRINTSiPR00405 REVINTRACTNG
SMARTiView protein in SMART
SM00105 ArfGap, 1 hit
SM00233 PH, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
SSF57863 SSF57863, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50115 ARFGAP, 1 hit
PS50003 PH_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAGAP9_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5VTM2
Secondary accession number(s): D3YTF3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: April 17, 2007
Last modified: December 5, 2018
This is version 119 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again