Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 9

Gene

AGAP9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Protein inferred from homologyi

Functioni

Putative GTPase-activating protein.Curated

Miscellaneous

Encoded by one of the numerous copies of centaurin gamma-like genes clustered in the q11 region of chromosome 10.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri524 – 547C4-typePROSITE-ProRule annotationAdd BLAST24

GO - Molecular functioni

Keywordsi

Molecular functionGTPase activation
LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 9
Short name:
AGAP-9
Alternative name(s):
Centaurin-gamma-like family member 6
Gene namesi
Name:AGAP9
Synonyms:CTGLF6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000204172.12
HGNCiHGNC:23463 AGAP9
neXtProtiNX_Q5VTM2

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000204172

Polymorphism and mutation databases

DMDMi145558891

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002846771 – 703Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 9Add BLAST703

Proteomic databases

PaxDbiQ5VTM2
PeptideAtlasiQ5VTM2
PRIDEiQ5VTM2
ProteomicsDBi65337

PTM databases

iPTMnetiQ5VTM2
PhosphoSitePlusiQ5VTM2

Expressioni

Gene expression databases

BgeeiENSG00000204172 Expressed in 90 organ(s), highest expression level in body of pancreas
CleanExiHS_AGAP9
GenevisibleiQ5VTM2 HS

Organism-specific databases

HPAiHPA042490

Interactioni

Protein-protein interaction databases

IntActiQ5VTM2, 1 interactor
STRINGi9606.ENSP00000407436

Structurei

3D structure databases

ProteinModelPortaliQ5VTM2
SMRiQ5VTM2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini327 – 488PHPROSITE-ProRule annotationAdd BLAST162
Domaini509 – 629Arf-GAPPROSITE-ProRule annotationAdd BLAST121
Repeati631 – 700ANKAdd BLAST70

Sequence similaritiesi

Belongs to the centaurin gamma-like family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri524 – 547C4-typePROSITE-ProRule annotationAdd BLAST24

Keywords - Domaini

ANK repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG0705 Eukaryota
KOG1951 Eukaryota
COG5192 LUCA
COG5347 LUCA
GeneTreeiENSGT00760000118874
HOGENOMiHOG000007233
HOVERGENiHBG054045
InParanoidiQ5VTM2
OMAiKEWWIRS
OrthoDBiEOG091G123A
PhylomeDBiQ5VTM2
TreeFamiTF317762

Family and domain databases

Gene3Di1.25.40.20, 1 hit
3.30.40.160, 1 hit
InterProiView protein in InterPro
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR037278 ARFGAP/RecO
IPR001164 ArfGAP_dom
IPR038508 ArfGAP_dom_sf
IPR027417 P-loop_NTPase
IPR001849 PH_domain
PfamiView protein in Pfam
PF01412 ArfGap, 1 hit
PRINTSiPR00405 REVINTRACTNG
SMARTiView protein in SMART
SM00105 ArfGap, 1 hit
SM00233 PH, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
SSF57863 SSF57863, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50115 ARFGAP, 1 hit
PS50003 PH_DOMAIN, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q5VTM2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFEDVFSDSG NTGNFDRGKK RRLTIIECGC DINMMIDLAK VADLVLMLID
60 70 80 90 100
ASFGFEMEMF EFLNICQAHG FPKILGVLTH LDSFKHNKQL KKTKKRLKHR
110 120 130 140 150
FWTEVYQDKV GLTHELVQSL ISTYSTIDAK MASSRVTLLS NSKPLGSEAI
160 170 180 190 200
DNQGVSLEFD QQQGSVCPSE SEIYEAGAED RMAGAPMAAA VQPAEVTVEV
210 220 230 240 250
GEDLHMHQVR DREMPEVVEI RRSNCTNHCD LGDTSSYHTK VSTVHIMKKR
260 270 280 290 300
NGGGSLNNYS SSIPPTPSTS QEDPQFSVPP TANTPTPVCK RSMRWSNLFT
310 320 330 340 350
SEKGSDPDKE RKAPENHADT IGSGRAIPIK QGMLLKRSGK WLKTWKKKYV
360 370 380 390 400
TLCSNGVLTY YSSLGDYMKN IHKKEIDLRT STIKVPGKWP SLATSACAPI
410 420 430 440 450
SSSKSNGLSK DMDTGLGDSI CFSPGISSTT SPKLNPPPSP HANKKKHLKK
460 470 480 490 500
KSTNNFMIVS ATGQTWHFEA TTYEERDAWV QAIQSQILAS LQSCKSSKSK
510 520 530 540 550
SQLTSQSEAM ALQSIQNMRG NAHCVDCETQ NPKWASLNLG VLMCIECSGI
560 570 580 590 600
HRSFGTRLSR VRSLELDDWP VELRKVMSSI GNELANSIWE GSSQGQTKPS
610 620 630 640 650
IKSTREEKEW WIRSKYEEKL FLAPLPCTEL SLGQQLLRAT TDEDLQTAIL
660 670 680 690 700
LLAHGSREEV NETCGEGDGC TALHLACRKG NVVLEQLLTG WTSWPEMPTG

TQR
Length:703
Mass (Da):77,972
Last modified:April 17, 2007 - v2
Checksum:i28D84F589E15A0EB
GO
Isoform 2 (identifier: Q5VTM2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-154: MFEDVFSDSG...LGSEAIDNQG → MGNILTCRVHPS
     216-216: E → EALEFNLSANPEASTIFQRNSQTDALEFNSSANPEASTIFQRNSQTD
     229-240: CDLGDTSSYHTK → VSTERFSQQYSSCSTIFLDDSTAIQHYLTMTIISVTLEIPHHITQRDADRSLSIPDEQLHSFA

Note: No experimental confirmation available.
Show »
Length:658
Mass (Da):72,750
Checksum:iCEA1E89921371BA5
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti495K → E in BC171845 (PubMed:15489334).Curated1
Sequence conflicti508E → K in BC171845 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0445491 – 154MFEDV…IDNQG → MGNILTCRVHPS in isoform 2. 1 PublicationAdd BLAST154
Alternative sequenceiVSP_044550216E → EALEFNLSANPEASTIFQRN SQTDALEFNSSANPEASTIF QRNSQTD in isoform 2. 1 Publication1
Alternative sequenceiVSP_044551229 – 240CDLGD…SYHTK → VSTERFSQQYSSCSTIFLDD STAIQHYLTMTIISVTLEIP HHITQRDADRSLSIPDEQLH SFA in isoform 2. 1 PublicationAdd BLAST12

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL591684 Genomic DNA No translation available.
BC171845 Genomic DNA No translation available.
CCDSiCCDS73125.1 [Q5VTM2-2]
RefSeqiNP_001177739.1, NM_001190810.1 [Q5VTM2-2]
UniGeneiHs.645346
Hs.742298

Genome annotation databases

EnsembliENST00000452145; ENSP00000392206; ENSG00000204172 [Q5VTM2-2]
GeneIDi642517
KEGGihsa:642517
UCSCiuc057tbu.1 human [Q5VTM2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL591684 Genomic DNA No translation available.
BC171845 Genomic DNA No translation available.
CCDSiCCDS73125.1 [Q5VTM2-2]
RefSeqiNP_001177739.1, NM_001190810.1 [Q5VTM2-2]
UniGeneiHs.645346
Hs.742298

3D structure databases

ProteinModelPortaliQ5VTM2
SMRiQ5VTM2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ5VTM2, 1 interactor
STRINGi9606.ENSP00000407436

PTM databases

iPTMnetiQ5VTM2
PhosphoSitePlusiQ5VTM2

Polymorphism and mutation databases

DMDMi145558891

Proteomic databases

PaxDbiQ5VTM2
PeptideAtlasiQ5VTM2
PRIDEiQ5VTM2
ProteomicsDBi65337

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000452145; ENSP00000392206; ENSG00000204172 [Q5VTM2-2]
GeneIDi642517
KEGGihsa:642517
UCSCiuc057tbu.1 human [Q5VTM2-1]

Organism-specific databases

CTDi642517
EuPathDBiHostDB:ENSG00000204172.12
GeneCardsiAGAP9
HGNCiHGNC:23463 AGAP9
HPAiHPA042490
neXtProtiNX_Q5VTM2
OpenTargetsiENSG00000204172
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0705 Eukaryota
KOG1951 Eukaryota
COG5192 LUCA
COG5347 LUCA
GeneTreeiENSGT00760000118874
HOGENOMiHOG000007233
HOVERGENiHBG054045
InParanoidiQ5VTM2
OMAiKEWWIRS
OrthoDBiEOG091G123A
PhylomeDBiQ5VTM2
TreeFamiTF317762

Miscellaneous databases

ChiTaRSiAGAP9 human
GenomeRNAii642517
PROiPR:Q5VTM2

Gene expression databases

BgeeiENSG00000204172 Expressed in 90 organ(s), highest expression level in body of pancreas
CleanExiHS_AGAP9
GenevisibleiQ5VTM2 HS

Family and domain databases

Gene3Di1.25.40.20, 1 hit
3.30.40.160, 1 hit
InterProiView protein in InterPro
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR037278 ARFGAP/RecO
IPR001164 ArfGAP_dom
IPR038508 ArfGAP_dom_sf
IPR027417 P-loop_NTPase
IPR001849 PH_domain
PfamiView protein in Pfam
PF01412 ArfGap, 1 hit
PRINTSiPR00405 REVINTRACTNG
SMARTiView protein in SMART
SM00105 ArfGap, 1 hit
SM00233 PH, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
SSF57863 SSF57863, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50115 ARFGAP, 1 hit
PS50003 PH_DOMAIN, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiAGAP9_HUMAN
AccessioniPrimary (citable) accession number: Q5VTM2
Secondary accession number(s): D3YTF3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: April 17, 2007
Last modified: September 12, 2018
This is version 117 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again