Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Annexin A8-like protein 1

Gene

ANXA8L1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi266Calcium; via carbonyl oxygenBy similarity1
Metal bindingi268Calcium; via carbonyl oxygenBy similarity1
Metal bindingi270Calcium; via carbonyl oxygenBy similarity1
Metal bindingi310CalciumBy similarity1

GO - Molecular functioni

Keywordsi

LigandCalcium, Calcium/phospholipid-binding, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Annexin A8-like protein 1Curated
Gene namesi
Name:ANXA8L1Imported
Synonyms:ANXA8L2Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000264230.7
HGNCiHGNC:23334 ANXA8L1
neXtProtiNX_Q5VT79

Pathology & Biotechi

Organism-specific databases

DisGeNETi653145
728113
OpenTargetsiENSG00000264230
PharmGKBiPA134927491

Polymorphism and mutation databases

DMDMi74756781

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003289391 – 327Annexin A8-like protein 1Add BLAST327

Proteomic databases

EPDiQ5VT79
PaxDbiQ5VT79
PeptideAtlasiQ5VT79
PRIDEiQ5VT79
ProteomicsDBi65310
65311 [Q5VT79-2]

PTM databases

iPTMnetiQ5VT79
PhosphoSitePlusiQ5VT79

Expressioni

Gene expression databases

BgeeiENSG00000264230
CleanExiHS_ANXA8L2
ExpressionAtlasiQ5VT79 baseline and differential

Organism-specific databases

HPAiHPA045246
HPA047451

Interactioni

Protein-protein interaction databases

BioGridi608549, 9 interactors
STRINGi9606.ENSP00000363395

Structurei

3D structure databases

ProteinModelPortaliQ5VT79
SMRiQ5VT79
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati25 – 90Annexin 1Sequence analysisAdd BLAST66
Repeati97 – 162Annexin 2Sequence analysisAdd BLAST66
Repeati181 – 247Annexin 3Sequence analysisAdd BLAST67
Repeati257 – 322Annexin 4Sequence analysisAdd BLAST66

Domaini

A pair of annexin repeats may form one binding site for calcium and phospholipid.By similarity

Sequence similaritiesi

Belongs to the annexin family.Sequence analysis

Keywords - Domaini

Annexin, Repeat

Phylogenomic databases

eggNOGiKOG0819 Eukaryota
ENOG410XPUN LUCA
GeneTreeiENSGT00760000118972
HOGENOMiHOG000158803
HOVERGENiHBG061815
InParanoidiQ5VT79
KOiK17096
TreeFamiTF105452

Family and domain databases

Gene3Di1.10.220.10, 4 hits
InterProiView protein in InterPro
IPR001464 Annexin
IPR018502 Annexin_repeat
IPR018252 Annexin_repeat_CS
IPR037104 Annexin_sf
IPR009115 ANX8
PANTHERiPTHR10502:SF133 PTHR10502:SF133, 1 hit
PfamiView protein in Pfam
PF00191 Annexin, 4 hits
PRINTSiPR00196 ANNEXIN
PR01808 ANNEXINVIII
SMARTiView protein in SMART
SM00335 ANX, 4 hits
PROSITEiView protein in PROSITE
PS00223 ANNEXIN, 4 hits

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q5VT79-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAWWKAWIEQ EGVTVKSSSH FNPDPDAETL YKAMKGIGTN EQAIIDVLTK
60 70 80 90 100
RSNTQRQQIA KSFKAQFGKD LTETLKSELS GKFERLIVAL MYPPYRYEAK
110 120 130 140 150
ELHDAMKGLG TKEGVIIEIL ASRTKNQLRE IMKAYEEDYG SSLEEDIQAD
160 170 180 190 200
TSGYLERILV CLLQGSRDDV SSFVDPALAL QDAQDLYAAG EKIRGTDEMK
210 220 230 240 250
FITILCTRSA THLLRVFEEY EKIANKSIED SIKSETHGSL EEAMLTVVKC
260 270 280 290 300
TQNLHSYFAE RLYYAMKGAG TRDGTLIRNI VSRSEIDLNL IKCHFKKMYG
310 320
KTLSSMIMED TSGDYKNALL SLVGSDP
Note: No experimental confirmation available.Curated
Length:327
Mass (Da):36,879
Last modified:July 22, 2015 - v2
Checksum:i3AAEE1D7072A9379
GO
Isoform 22 Publications (identifier: Q5VT79-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     38-38: G → GVGSQLLSHQAAAFAFPSSALTSVSPWGQQGHLCCNPAG
     109-165: Missing.
     217-248: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:276
Mass (Da):30,691
Checksum:i95FF53E36BA64F58
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_067447134A → V2 Publications1
Natural variantiVAR_048254177A → G. Corresponds to variant dbSNP:rs3013886Ensembl.1
Natural variantiVAR_067448192K → N1 PublicationCorresponds to variant dbSNP:rs977788Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05278238G → GVGSQLLSHQAAAFAFPSSA LTSVSPWGQQGHLCCNPAG in isoform 2. 2 Publications1
Alternative sequenceiVSP_052783109 – 165Missing in isoform 2. 2 PublicationsAdd BLAST57
Alternative sequenceiVSP_052784217 – 248Missing in isoform 2. 2 PublicationsAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK223149 mRNA Translation: BAD96869.1
AK313626 mRNA Translation: BAG36386.1
AC244230 Genomic DNA No translation available.
AL603965 Genomic DNA Translation: CAH70574.1
AL603965 Genomic DNA Translation: CAH70575.1
AL732434 Genomic DNA No translation available.
BC008813 mRNA Translation: AAH08813.3
CCDSiCCDS73097.1 [Q5VT79-2]
CCDS73098.1 [Q5VT79-1]
RefSeqiNP_001092315.2, NM_001098845.2 [Q5VT79-1]
NP_001265853.1, NM_001278924.1 [Q5VT79-2]
UniGeneiHs.705389

Genome annotation databases

EnsembliENST00000619162; ENSP00000480221; ENSG00000264230 [Q5VT79-1]
ENST00000622769; ENSP00000483608; ENSG00000264230 [Q5VT79-2]
GeneIDi728113
KEGGihsa:728113

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiAXA81_HUMAN
AccessioniPrimary (citable) accession number: Q5VT79
Secondary accession number(s): A0A0B4J2D4
, B2R939, Q53FY2, Q5VT78, Q96H89
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: July 22, 2015
Last modified: June 20, 2018
This is version 119 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health