Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 129 (18 Sep 2019)
Sequence version 2 (22 Jul 2015)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Annexin A8-like protein 1

Gene

ANXA8L1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi266Calcium; via carbonyl oxygenBy similarity1
Metal bindingi268Calcium; via carbonyl oxygenBy similarity1
Metal bindingi270Calcium; via carbonyl oxygenBy similarity1
Metal bindingi310CalciumBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandCalcium, Calcium/phospholipid-binding, Metal-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Annexin A8-like protein 1Curated
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ANXA8L1Imported
Synonyms:ANXA8L2Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:23334 ANXA8L1

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5VT79

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
653145
728113

Open Targets

More...
OpenTargetsi
ENSG00000264230

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134927491

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ANXA8L1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74756781

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003289391 – 327Annexin A8-like protein 1Add BLAST327

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q5VT79

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5VT79

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q5VT79

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5VT79

PeptideAtlas

More...
PeptideAtlasi
Q5VT79

PRoteomics IDEntifications database

More...
PRIDEi
Q5VT79

ProteomicsDB human proteome resource

More...
ProteomicsDBi
65310 [Q5VT79-1]
65311 [Q5VT79-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5VT79

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5VT79

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q5VT79

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000264230 Expressed in 82 organ(s), highest expression level in skin of abdomen

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5VT79 baseline and differential

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA045246
HPA047451

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
608549, 9 interactors

Protein interaction database and analysis system

More...
IntActi
Q5VT79, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000480221

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q5VT79

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati21 – 92Annexin 1PROSITE-ProRule annotationAdd BLAST72
Repeati93 – 164Annexin 2PROSITE-ProRule annotationAdd BLAST72
Repeati177 – 249Annexin 3PROSITE-ProRule annotationAdd BLAST73
Repeati253 – 324Annexin 4PROSITE-ProRule annotationAdd BLAST72

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

A pair of annexin repeats may form one binding site for calcium and phospholipid.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the annexin family.PROSITE-ProRule annotation

Keywords - Domaini

Annexin, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0819 Eukaryota
ENOG410XPUN LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161044

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000158803

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5VT79

KEGG Orthology (KO)

More...
KOi
K17096

Database of Orthologous Groups

More...
OrthoDBi
856254at2759

TreeFam database of animal gene trees

More...
TreeFami
TF105452

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.220.10, 4 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001464 Annexin
IPR018502 Annexin_repeat
IPR018252 Annexin_repeat_CS
IPR037104 Annexin_sf
IPR009115 ANX8

The PANTHER Classification System

More...
PANTHERi
PTHR10502:SF133 PTHR10502:SF133, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00191 Annexin, 4 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00196 ANNEXIN
PR01808 ANNEXINVIII

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00335 ANX, 4 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00223 ANNEXIN_1, 4 hits
PS51897 ANNEXIN_2, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: Q5VT79-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAWWKAWIEQ EGVTVKSSSH FNPDPDAETL YKAMKGIGTN EQAIIDVLTK
60 70 80 90 100
RSNTQRQQIA KSFKAQFGKD LTETLKSELS GKFERLIVAL MYPPYRYEAK
110 120 130 140 150
ELHDAMKGLG TKEGVIIEIL ASRTKNQLRE IMKAYEEDYG SSLEEDIQAD
160 170 180 190 200
TSGYLERILV CLLQGSRDDV SSFVDPALAL QDAQDLYAAG EKIRGTDEMK
210 220 230 240 250
FITILCTRSA THLLRVFEEY EKIANKSIED SIKSETHGSL EEAMLTVVKC
260 270 280 290 300
TQNLHSYFAE RLYYAMKGAG TRDGTLIRNI VSRSEIDLNL IKCHFKKMYG
310 320
KTLSSMIMED TSGDYKNALL SLVGSDP
Note: No experimental confirmation available.Curated
Length:327
Mass (Da):36,879
Last modified:July 22, 2015 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3AAEE1D7072A9379
GO
Isoform 22 Publications (identifier: Q5VT79-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     38-38: G → GVGSQLLSHQAAAFAFPSSALTSVSPWGQQGHLCCNPAG
     109-165: Missing.
     217-248: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:276
Mass (Da):30,691
Checksum:i95FF53E36BA64F58
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B4DTF2B4DTF2_HUMAN
Annexin
ANXA8L1
270Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A075B752A0A075B752_HUMAN
Annexin
ANXA8L1
365Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WUP0A0A087WUP0_HUMAN
Annexin
ANXA8L1
265Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_067447134A → V2 PublicationsCorresponds to variant dbSNP:rs201596209Ensembl.1
Natural variantiVAR_048254177A → G. Corresponds to variant dbSNP:rs3013886Ensembl.1
Natural variantiVAR_067448192K → N1 PublicationCorresponds to variant dbSNP:rs977788Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_05278238G → GVGSQLLSHQAAAFAFPSSA LTSVSPWGQQGHLCCNPAG in isoform 2. 2 Publications1
Alternative sequenceiVSP_052783109 – 165Missing in isoform 2. 2 PublicationsAdd BLAST57
Alternative sequenceiVSP_052784217 – 248Missing in isoform 2. 2 PublicationsAdd BLAST32

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK223149 mRNA Translation: BAD96869.1
AK313626 mRNA Translation: BAG36386.1
AC244230 Genomic DNA No translation available.
AL603965 Genomic DNA Translation: CAH70574.1
AL603965 Genomic DNA Translation: CAH70575.1
AL732434 Genomic DNA No translation available.
BC008813 mRNA Translation: AAH08813.3

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS73097.1 [Q5VT79-2]
CCDS73098.1 [Q5VT79-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001092315.2, NM_001098845.2 [Q5VT79-1]
NP_001265853.1, NM_001278924.1 [Q5VT79-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000619162; ENSP00000480221; ENSG00000264230 [Q5VT79-1]
ENST00000622769; ENSP00000483608; ENSG00000264230 [Q5VT79-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
728113

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:728113

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK223149 mRNA Translation: BAD96869.1
AK313626 mRNA Translation: BAG36386.1
AC244230 Genomic DNA No translation available.
AL603965 Genomic DNA Translation: CAH70574.1
AL603965 Genomic DNA Translation: CAH70575.1
AL732434 Genomic DNA No translation available.
BC008813 mRNA Translation: AAH08813.3
CCDSiCCDS73097.1 [Q5VT79-2]
CCDS73098.1 [Q5VT79-1]
RefSeqiNP_001092315.2, NM_001098845.2 [Q5VT79-1]
NP_001265853.1, NM_001278924.1 [Q5VT79-2]

3D structure databases

SMRiQ5VT79
ModBaseiSearch...

Protein-protein interaction databases

BioGridi608549, 9 interactors
IntActiQ5VT79, 2 interactors
STRINGi9606.ENSP00000480221

PTM databases

iPTMnetiQ5VT79
PhosphoSitePlusiQ5VT79
SwissPalmiQ5VT79

Polymorphism and mutation databases

BioMutaiANXA8L1
DMDMi74756781

Proteomic databases

EPDiQ5VT79
jPOSTiQ5VT79
MassIVEiQ5VT79
PaxDbiQ5VT79
PeptideAtlasiQ5VT79
PRIDEiQ5VT79
ProteomicsDBi65310 [Q5VT79-1]
65311 [Q5VT79-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
244
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000619162; ENSP00000480221; ENSG00000264230 [Q5VT79-1]
ENST00000622769; ENSP00000483608; ENSG00000264230 [Q5VT79-2]
GeneIDi728113
KEGGihsa:728113

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
728113
DisGeNETi653145
728113

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ANXA8L1
HGNCiHGNC:23334 ANXA8L1
HPAiHPA045246
HPA047451
neXtProtiNX_Q5VT79
OpenTargetsiENSG00000264230
PharmGKBiPA134927491

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0819 Eukaryota
ENOG410XPUN LUCA
GeneTreeiENSGT00940000161044
HOGENOMiHOG000158803
InParanoidiQ5VT79
KOiK17096
OrthoDBi856254at2759
TreeFamiTF105452

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ANXA8L1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
728113

Pharos

More...
Pharosi
Q5VT79

Protein Ontology

More...
PROi
PR:Q5VT79

Gene expression databases

BgeeiENSG00000264230 Expressed in 82 organ(s), highest expression level in skin of abdomen
ExpressionAtlasiQ5VT79 baseline and differential

Family and domain databases

Gene3Di1.10.220.10, 4 hits
InterProiView protein in InterPro
IPR001464 Annexin
IPR018502 Annexin_repeat
IPR018252 Annexin_repeat_CS
IPR037104 Annexin_sf
IPR009115 ANX8
PANTHERiPTHR10502:SF133 PTHR10502:SF133, 1 hit
PfamiView protein in Pfam
PF00191 Annexin, 4 hits
PRINTSiPR00196 ANNEXIN
PR01808 ANNEXINVIII
SMARTiView protein in SMART
SM00335 ANX, 4 hits
PROSITEiView protein in PROSITE
PS00223 ANNEXIN_1, 4 hits
PS51897 ANNEXIN_2, 4 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAXA81_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5VT79
Secondary accession number(s): A0A0B4J2D4
, B2R939, Q53FY2, Q5VT78, Q96H89
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: July 22, 2015
Last modified: September 18, 2019
This is version 129 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again