Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 159 (12 Aug 2020)
Sequence version 1 (07 Dec 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Serine/threonine-protein kinase MRCK alpha

Gene

CDC42BPA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Serine/threonine-protein kinase which is an important downstream effector of CDC42 and plays a role in the regulation of cytoskeleton reorganization and cell migration (PubMed:15723050, PubMed:9418861, PubMed:9092543). Regulates actin cytoskeletal reorganization via phosphorylation of PPP1R12C and MYL9/MLC2 (PubMed:21457715). In concert with MYO18A and LURAP1, is involved in modulating lamellar actomyosin retrograde flow that is crucial to cell protrusion and migration (PubMed:18854160). Phosphorylates: PPP1R12A, LIMK1 and LIMK2 (PubMed:11340065, PubMed:11399775). May play a role in TFRC-mediated iron uptake (PubMed:20188707). In concert with FAM89B/LRAP25 mediates the targeting of LIMK1 to the lamellipodium resulting in its activation and subsequent phosphorylation of CFL1 which is important for lamellipodial F-actin regulation (By similarity). Triggers the formation of an extrusion apical actin ring required for epithelial extrusion of apoptotic cells (PubMed:29162624).By similarity9 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Maintained in an inactive, closed conformation by an interaction between the kinase domain and the negative autoregulatory C-terminal coiled-coil region. Agonist binding to the phorbol ester binding site disrupts this, releasing the kinase domain to allow N-terminus-mediated dimerization and kinase activation by transautophosphorylation. Inhibited by chelerythrine chloride.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei106ATPPROSITE-ProRule annotation1 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei201Proton acceptorPROSITE-ProRule annotationBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi83 – 91ATPPROSITE-ProRule annotationBy similarity9
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri1012 – 1062Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd BLAST51

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
LigandATP-binding, Magnesium, Metal-binding, Nucleotide-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q5VT25

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q5VT25

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q5VT25

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Serine/threonine-protein kinase MRCK alpha (EC:2.7.11.11 Publication)
Alternative name(s):
CDC42-binding protein kinase alpha
DMPK-like alpha
Myotonic dystrophy kinase-related CDC42-binding kinase alpha
Short name:
MRCK alpha
Short name:
Myotonic dystrophy protein kinase-like alpha
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CDC42BPAImported
Synonyms:KIAA0451
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000143776.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1737, CDC42BPA

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603412, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5VT25

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi106K → A: Loss of kinase activity. 1 Publication1
Mutagenesisi222S → L: Increase in autophosphorylation but not kinase activity. 1 Publication1
Mutagenesisi234S → A: Loss of autophosphorylation and kinase activity. 1 Publication1
Mutagenesisi240T → A: Loss of autophosphorylation and kinase activity. 1 Publication1
Mutagenesisi403T → A: Loss of autophosphorylation and kinase activity. 1 Publication1
Mutagenesisi478D → A: Prevents cleavage by CASP3, impairs the increase of its kinase activity and impairs extrusion apical actin ring assembly. 1 Publication1
Mutagenesisi984D → A: Prevents cleavage by CASP3. 1 Publication1
Mutagenesisi1579H → A: Loss of CDC42 binding; when associated with A-1582. 1 Publication1
Mutagenesisi1582H → A: Loss of CDC42 binding; when associated with A-1579. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
8476

Open Targets

More...
OpenTargetsi
ENSG00000143776

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26267

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q5VT25, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL4516

DrugCentral

More...
DrugCentrali
Q5VT25

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
1507

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CDC42BPA

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74746874

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000863921 – 1732Serine/threonine-protein kinase MRCK alphaAdd BLAST1732

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei222Phosphoserine; by autocatalysis1 Publication1
Modified residuei234Phosphoserine; by autocatalysis1 Publication1
Modified residuei240Phosphothreonine; by autocatalysis1 Publication1
Modified residuei1127PhosphoserineBy similarity1
Modified residuei1545PhosphoserineCombined sources1
Modified residuei1611PhosphoserineCombined sources1
Modified residuei1613PhosphoserineCombined sources1
Modified residuei1629PhosphoserineCombined sources1
Modified residuei1651PhosphoserineCombined sources1
Modified residuei1664PhosphoserineCombined sources1
Modified residuei1669PhosphoserineCombined sources1
Modified residuei1693PhosphoserineCombined sources1
Modified residuei1719PhosphoserineCombined sources1
Modified residuei1721PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Proteolytically cleaved by caspases upon apoptosis induction. The cleavage at Asp-478 by CASP3 increases its kinase activity (in vitro).1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei478 – 479Cleavage; by CASP3 in vitro1 Publication2
Sitei984 – 985Cleavage; by CASP3 in vitro1 Publication2

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q5VT25

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5VT25

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q5VT25

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q5VT25

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5VT25

PeptideAtlas

More...
PeptideAtlasi
Q5VT25

PRoteomics IDEntifications database

More...
PRIDEi
Q5VT25

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
65291 [Q5VT25-1]
65292 [Q5VT25-2]
65293 [Q5VT25-3]
65294 [Q5VT25-4]
65295 [Q5VT25-5]
65296 [Q5VT25-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5VT25

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5VT25

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Abundant in the heart, brain, skeletal muscle, kidney, and pancreas, with little or no expression in the lung and liver.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Regulated by cellular iron levels.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000143776, Expressed in medial globus pallidus and 251 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5VT25, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5VT25, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000143776, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer and homotetramer via the coiled coil regions (PubMed:11283256).

Interacts tightly with GTP-bound but not GDP-bound CDC42 (PubMed:9418861).

Forms a tripartite complex with MYO18A and LURAP1 with the latter acting as an adapter connecting CDC42BPA and MYO18A. LURAP1 binding results in activation of CDC42BPA by abolition of its negative autoregulation (PubMed:18854160).

Interacts with LURAP1.

Interacts (via AGC-kinase C-terminal domain) with FAM89B/LRAP25 (via LRR repeat).

Forms a tripartite complex with FAM89B/LRAP25 and LIMK1 (By similarity).

By similarity3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
114051, 39 interactors

Protein interaction database and analysis system

More...
IntActi
Q5VT25, 36 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000355731

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q5VT25

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q5VT25, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q5VT25

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini77 – 343Protein kinasePROSITE-ProRule annotation1 PublicationAdd BLAST267
Domaini344 – 414AGC-kinase C-terminalAdd BLAST71
Domaini1082 – 1201PHPROSITE-ProRule annotationAdd BLAST120
Domaini1227 – 1499CNHPROSITE-ProRule annotationAdd BLAST273
Domaini1571 – 1584CRIBPROSITE-ProRule annotationAdd BLAST14

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili437 – 820Sequence analysisAdd BLAST384
Coiled coili880 – 943Sequence analysisAdd BLAST64

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri1012 – 1062Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd BLAST51

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0612, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00990000203642

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_000288_140_3_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5VT25

KEGG Orthology (KO)

More...
KOi
K16307

Identification of Orthologs from Complete Genome Data

More...
OMAi
KKACPGS

Database of Orthologous Groups

More...
OrthoDBi
759391at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5VT25

TreeFam database of animal gene trees

More...
TreeFami
TF313551

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00029, C1, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000961, AGC-kinase_C
IPR001180, CNH_dom
IPR000095, CRIB_dom
IPR031597, KELK
IPR011009, Kinase-like_dom_sf
IPR014930, Myotonic_dystrophy_kinase_coil
IPR002219, PE/DAG-bd
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR017892, Pkinase_C
IPR000719, Prot_kinase_dom
IPR017441, Protein_kinase_ATP_BS
IPR008271, Ser/Thr_kinase_AS
IPR026611, Ser/Thr_kinase_MRCK_alpha

The PANTHER Classification System

More...
PANTHERi
PTHR22988:SF31, PTHR22988:SF31, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00130, C1_1, 1 hit
PF00780, CNH, 1 hit
PF08826, DMPK_coil, 1 hit
PF15796, KELK, 1 hit
PF00069, Pkinase, 1 hit
PF00433, Pkinase_C, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00109, C1, 1 hit
SM00036, CNH, 1 hit
SM00285, PBD, 1 hit
SM00233, PH, 1 hit
SM00133, S_TK_X, 1 hit
SM00220, S_TKc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56112, SSF56112, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51285, AGC_KINASE_CTER, 1 hit
PS50219, CNH, 1 hit
PS50108, CRIB, 1 hit
PS50003, PH_DOMAIN, 1 hit
PS00107, PROTEIN_KINASE_ATP, 1 hit
PS50011, PROTEIN_KINASE_DOM, 1 hit
PS00108, PROTEIN_KINASE_ST, 1 hit
PS00479, ZF_DAG_PE_1, 1 hit
PS50081, ZF_DAG_PE_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist. They arise due to a two alternate splice sites, the first site involves splicing of exons 21-24 while the second site involves exons 36-40.

This entry has 6 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1Curated (identifier: Q5VT25-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSGEVRLRQL EQFILDGPAQ TNGQCFSVET LLDILICLYD ECNNSPLRRE
60 70 80 90 100
KNILEYLEWA KPFTSKVKQM RLHREDFEIL KVIGRGAFGE VAVVKLKNAD
110 120 130 140 150
KVFAMKILNK WEMLKRAETA CFREERDVLV NGDNKWITTL HYAFQDDNNL
160 170 180 190 200
YLVMDYYVGG DLLTLLSKFE DRLPEDMARF YLAEMVIAID SVHQLHYVHR
210 220 230 240 250
DIKPDNILMD MNGHIRLADF GSCLKLMEDG TVQSSVAVGT PDYISPEILQ
260 270 280 290 300
AMEDGKGRYG PECDWWSLGV CMYEMLYGET PFYAESLVET YGKIMNHKER
310 320 330 340 350
FQFPAQVTDV SENAKDLIRR LICSREHRLG QNGIEDFKKH PFFSGIDWDN
360 370 380 390 400
IRNCEAPYIP EVSSPTDTSN FDVDDDCLKN SETMPPPTHT AFSGHHLPFV
410 420 430 440 450
GFTYTSSCVL SDRSCLRVTA GPTSLDLDVN VQRTLDNNLA TEAYERRIKR
460 470 480 490 500
LEQEKLELSR KLQESTQTVQ ALQYSTVDGP LTASKDLEIK NLKEEIEKLR
510 520 530 540 550
KQVTESSHLE QQLEEANAVR QELDDAFRQI KAYEKQIKTL QQEREDLNKE
560 570 580 590 600
LVQASERLKN QSKELKDAHC QRKLAMQEFM EINERLTELH TQKQKLARHV
610 620 630 640 650
RDKEEEVDLV MQKVESLRQE LRRTERAKKE LEVHTEALAA EASKDRKLRE
660 670 680 690 700
QSEHYSKQLE NELEGLKQKQ ISYSPGVCSI EHQQEITKLK TDLEKKSIFY
710 720 730 740 750
EEELSKREGI HANEIKNLKK ELHDSEGQQL ALNKEIMILK DKLEKTRRES
760 770 780 790 800
QSEREEFESE FKQQYEREKV LLTEENKKLT SELDKLTTLY ENLSIHNQQL
810 820 830 840 850
EEEVKDLADK KESVAHWEAQ ITEIIQWVSD EKDARGYLQA LASKMTEELE
860 870 880 890 900
ALRNSSLGTR ATDMPWKMRR FAKLDMSARL ELQSALDAEI RAKQAIQEEL
910 920 930 940 950
NKVKASNIIT ECKLKDSEKK NLELLSEIEQ LIKDTEELRS EKGIEHQDSQ
960 970 980 990 1000
HSFLAFLNTP TDALDQFERS PSCTPASKGR RTVDSTPLSV HTPTLRKKGC
1010 1020 1030 1040 1050
PGSTGFPPKR KTHQFFVKSF TTPTKCHQCT SLMVGLIRQG CSCEVCGFSC
1060 1070 1080 1090 1100
HITCVNKAPT TCPVPPEQTK GPLGIDPQKG IGTAYEGHVR IPKPAGVKKG
1110 1120 1130 1140 1150
WQRALAIVCD FKLFLYDIAE GKASQPSVVI SQVIDMRDEE FSVSSVLASD
1160 1170 1180 1190 1200
VIHASRKDIP CIFRVTASQL SASNNKCSIL MLADTENEKN KWVGVLSELH
1210 1220 1230 1240 1250
KILKKNKFRD RSVYVPKEAY DSTLPLIKTT QAAAIIDHER IALGNEEGLF
1260 1270 1280 1290 1300
VVHVTKDEII RVGDNKKIHQ IELIPNDQLV AVISGRNRHV RLFPMSALDG
1310 1320 1330 1340 1350
RETDFYKLSE TKGCQTVTSG KVRHGALTCL CVAMKRQVLC YELFQSKTRH
1360 1370 1380 1390 1400
RKFKEIQVPY NVQWMAIFSE QLCVGFQSGF LRYPLNGEGN PYSMLHSNDH
1410 1420 1430 1440 1450
TLSFIAHQPM DAICAVEISS KEYLLCFNSI GIYTDCQGRR SRQQELMWPA
1460 1470 1480 1490 1500
NPSSCCYNAP YLSVYSENAV DIFDVNSMEW IQTLPLKKVR PLNNEGSLNL
1510 1520 1530 1540 1550
LGLETIRLIY FKNKMAEGDE LVVPETSDNS RKQMVRNINN KRRYSFRVPE
1560 1570 1580 1590 1600
EERMQQRREM LRDPEMRNKL ISNPTNFNHI AHMGPGDGIQ ILKDLPMNPR
1610 1620 1630 1640 1650
PQESRTVFSG SVSIPSITKS RPEPGRSMSA SSGLSARSSA QNGSALKREF
1660 1670 1680 1690 1700
SGGSYSAKRQ PMPSPSEGSL SSGGMDQGSD APARDFDGED SDSPRHSTAS
1710 1720 1730
NSSNLSSPPS PASPRKTKSL SLESTDRGSW DP
Length:1,732
Mass (Da):197,307
Last modified:December 7, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i48B10F81B5405A0A
GO
Isoform 2Curated (identifier: Q5VT25-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     969-969: R → TDPVENTYVWNPSVKFHIQSRST
     973-981: CTPASKGRR → TSSEAEPVK

Show »
Length:1,754
Mass (Da):199,811
Checksum:iF1CC5CC1ED23B388
GO
Isoform 31 Publication (identifier: Q5VT25-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     550-630: Missing.
     969-981: Missing.

Show »
Length:1,638
Mass (Da):186,113
Checksum:i7783E19090B345F7
GO
Isoform 41 Publication (identifier: Q5VT25-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     969-1009: Missing.

Show »
Length:1,691
Mass (Da):193,031
Checksum:i28E904E222CFFEC5
GO
Isoform 51 Publication (identifier: Q5VT25-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     969-981: Missing.

Show »
Length:1,719
Mass (Da):195,922
Checksum:iDBB15FA879AAC871
GO
Isoform 6 (identifier: Q5VT25-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     969-981: Missing.
     1597-1597: M → MPGFPYPSPHHHSGLISSPINFEHIYHMTVNSAEKFLSPDSINPEYSPSLRSVPGTPSFMTLR

Show »
Length:1,781
Mass (Da):202,812
Checksum:i979DA0EF4F17F9DF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MRJ0A0A0A0MRJ0_HUMAN
Non-specific serine/threonine prote...
CDC42BPA
1,699Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MRJ1A0A0A0MRJ1_HUMAN
Non-specific serine/threonine prote...
CDC42BPA
1,018Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y7V8H0Y7V8_HUMAN
Non-specific serine/threonine prote...
CDC42BPA
984Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y5V1H0Y5V1_HUMAN
Non-specific serine/threonine prote...
CDC42BPA
1,048Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y6V3H0Y6V3_HUMAN
Non-specific serine/threonine prote...
CDC42BPA
728Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y6R0H0Y6R0_HUMAN
Serine/threonine-protein kinase MRC...
CDC42BPA
546Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAD92205 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti25C → Y in AAB37126 (PubMed:9092543).Curated1
Sequence conflicti809D → N in CAI46252 (PubMed:17974005).Curated1
Sequence conflicti1521L → V (PubMed:9418861).Curated1
Sequence conflicti1688G → K in BAA32296 (PubMed:9455484).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04083050E → K in a lung neuroendocrine carcinoma sample; somatic mutation. 1 Publication1
Natural variantiVAR_040831231T → M1 PublicationCorresponds to variant dbSNP:rs34614709Ensembl.1
Natural variantiVAR_040832537I → T1 PublicationCorresponds to variant dbSNP:rs56364976Ensembl.1
Natural variantiVAR_045583780T → M1 PublicationCorresponds to variant dbSNP:rs56119119Ensembl.1
Natural variantiVAR_045584790Y → C1 PublicationCorresponds to variant dbSNP:rs34943764Ensembl.1
Natural variantiVAR_0455851148A → T1 PublicationCorresponds to variant dbSNP:rs56219089Ensembl.1
Natural variantiVAR_0455861211R → H1 PublicationCorresponds to variant dbSNP:rs961490Ensembl.1
Natural variantiVAR_0455871317V → I2 PublicationsCorresponds to variant dbSNP:rs1929860Ensembl.1
Natural variantiVAR_0408331418I → K1 Publication1
Natural variantiVAR_0455881469A → V1 PublicationCorresponds to variant dbSNP:rs55687355Ensembl.1
Natural variantiVAR_0455891618T → A1 PublicationCorresponds to variant dbSNP:rs2297417Ensembl.1
Natural variantiVAR_0455901699A → V. Corresponds to variant dbSNP:rs2802269Ensembl.1
Natural variantiVAR_0571041712A → V3 PublicationsCorresponds to variant dbSNP:rs2802269Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_051859550 – 630Missing in isoform 3. 1 PublicationAdd BLAST81
Alternative sequenceiVSP_051862969 – 1009Missing in isoform 4. 2 PublicationsAdd BLAST41
Alternative sequenceiVSP_051860969 – 981Missing in isoform 3, isoform 5 and isoform 6. 2 PublicationsAdd BLAST13
Alternative sequenceiVSP_051861969R → TDPVENTYVWNPSVKFHIQS RST in isoform 2. 1 Publication1
Alternative sequenceiVSP_051863973 – 981CTPASKGRR → TSSEAEPVK in isoform 2. 1 Publication9
Alternative sequenceiVSP_0352861597M → MPGFPYPSPHHHSGLISSPI NFEHIYHMTVNSAEKFLSPD SINPEYSPSLRSVPGTPSFM TLR in isoform 6. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ518975 mRNA Translation: CAD57745.1
AJ518976 mRNA Translation: CAD57746.1
AB208968 mRNA Translation: BAD92205.1 Different initiation.
CR933723 mRNA Translation: CAI46252.1
AL353689 Genomic DNA Translation: CAI19113.1
AL451047, AL353689, AL627308 Genomic DNA Translation: CAH71184.1
AL451047, AL627308, AL353689 Genomic DNA Translation: CAH71185.1
AL627308, AL353689, AL451047 Genomic DNA Translation: CAH71336.1
AL627308, AL353689, AL451047 Genomic DNA Translation: CAH71337.1
AL353689, AL451047, AL627308 Genomic DNA Translation: CAI19108.1
AL451047, AL353689, AL627308 Genomic DNA Translation: CAH71183.1
AL627308, AL353689, AL451047 Genomic DNA Translation: CAH71338.1
AL353689, AL627308, AL451047 Genomic DNA Translation: CAI19109.1
AL353689, AL451047, AL627308 Genomic DNA Translation: CAI19110.1
AB007920 mRNA Translation: BAA32296.2
U59305 mRNA Translation: AAB37126.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1558.1 [Q5VT25-5]
CCDS1559.1 [Q5VT25-3]

NCBI Reference Sequences

More...
RefSeqi
NP_003598.2, NM_003607.3 [Q5VT25-5]
NP_055641.3, NM_014826.4 [Q5VT25-3]
XP_005273378.1, XM_005273321.3 [Q5VT25-6]
XP_005273379.1, XM_005273322.3 [Q5VT25-2]
XP_005273381.1, XM_005273324.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000334218; ENSP00000335341; ENSG00000143776 [Q5VT25-1]
ENST00000366767; ENSP00000355729; ENSG00000143776 [Q5VT25-3]
ENST00000366769; ENSP00000355731; ENSG00000143776 [Q5VT25-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
8476

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:8476

UCSC genome browser

More...
UCSCi
uc001hqr.4, human [Q5VT25-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ518975 mRNA Translation: CAD57745.1
AJ518976 mRNA Translation: CAD57746.1
AB208968 mRNA Translation: BAD92205.1 Different initiation.
CR933723 mRNA Translation: CAI46252.1
AL353689 Genomic DNA Translation: CAI19113.1
AL451047, AL353689, AL627308 Genomic DNA Translation: CAH71184.1
AL451047, AL627308, AL353689 Genomic DNA Translation: CAH71185.1
AL627308, AL353689, AL451047 Genomic DNA Translation: CAH71336.1
AL627308, AL353689, AL451047 Genomic DNA Translation: CAH71337.1
AL353689, AL451047, AL627308 Genomic DNA Translation: CAI19108.1
AL451047, AL353689, AL627308 Genomic DNA Translation: CAH71183.1
AL627308, AL353689, AL451047 Genomic DNA Translation: CAH71338.1
AL353689, AL627308, AL451047 Genomic DNA Translation: CAI19109.1
AL353689, AL451047, AL627308 Genomic DNA Translation: CAI19110.1
AB007920 mRNA Translation: BAA32296.2
U59305 mRNA Translation: AAB37126.1
CCDSiCCDS1558.1 [Q5VT25-5]
CCDS1559.1 [Q5VT25-3]
RefSeqiNP_003598.2, NM_003607.3 [Q5VT25-5]
NP_055641.3, NM_014826.4 [Q5VT25-3]
XP_005273378.1, XM_005273321.3 [Q5VT25-6]
XP_005273379.1, XM_005273322.3 [Q5VT25-2]
XP_005273381.1, XM_005273324.3

3D structure databases

SMRiQ5VT25
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi114051, 39 interactors
IntActiQ5VT25, 36 interactors
STRINGi9606.ENSP00000355731

Chemistry databases

BindingDBiQ5VT25
ChEMBLiCHEMBL4516
DrugCentraliQ5VT25
GuidetoPHARMACOLOGYi1507

PTM databases

iPTMnetiQ5VT25
PhosphoSitePlusiQ5VT25

Polymorphism and mutation databases

BioMutaiCDC42BPA
DMDMi74746874

Proteomic databases

EPDiQ5VT25
jPOSTiQ5VT25
MassIVEiQ5VT25
MaxQBiQ5VT25
PaxDbiQ5VT25
PeptideAtlasiQ5VT25
PRIDEiQ5VT25
ProteomicsDBi65291 [Q5VT25-1]
65292 [Q5VT25-2]
65293 [Q5VT25-3]
65294 [Q5VT25-4]
65295 [Q5VT25-5]
65296 [Q5VT25-6]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
34655, 231 antibodies

The DNASU plasmid repository

More...
DNASUi
8476

Genome annotation databases

EnsembliENST00000334218; ENSP00000335341; ENSG00000143776 [Q5VT25-1]
ENST00000366767; ENSP00000355729; ENSG00000143776 [Q5VT25-3]
ENST00000366769; ENSP00000355731; ENSG00000143776 [Q5VT25-5]
GeneIDi8476
KEGGihsa:8476
UCSCiuc001hqr.4, human [Q5VT25-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
8476
DisGeNETi8476
EuPathDBiHostDB:ENSG00000143776.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CDC42BPA
HGNCiHGNC:1737, CDC42BPA
HPAiENSG00000143776, Low tissue specificity
MIMi603412, gene
neXtProtiNX_Q5VT25
OpenTargetsiENSG00000143776
PharmGKBiPA26267

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0612, Eukaryota
GeneTreeiENSGT00990000203642
HOGENOMiCLU_000288_140_3_1
InParanoidiQ5VT25
KOiK16307
OMAiKKACPGS
OrthoDBi759391at2759
PhylomeDBiQ5VT25
TreeFamiTF313551

Enzyme and pathway databases

PathwayCommonsiQ5VT25
SignaLinkiQ5VT25
SIGNORiQ5VT25

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
8476, 0 hits in 906 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CDC42BPA, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
CDC42BPA

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
8476
PharosiQ5VT25, Tchem

Protein Ontology

More...
PROi
PR:Q5VT25
RNActiQ5VT25, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000143776, Expressed in medial globus pallidus and 251 other tissues
ExpressionAtlasiQ5VT25, baseline and differential
GenevisibleiQ5VT25, HS

Family and domain databases

CDDicd00029, C1, 1 hit
Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR000961, AGC-kinase_C
IPR001180, CNH_dom
IPR000095, CRIB_dom
IPR031597, KELK
IPR011009, Kinase-like_dom_sf
IPR014930, Myotonic_dystrophy_kinase_coil
IPR002219, PE/DAG-bd
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR017892, Pkinase_C
IPR000719, Prot_kinase_dom
IPR017441, Protein_kinase_ATP_BS
IPR008271, Ser/Thr_kinase_AS
IPR026611, Ser/Thr_kinase_MRCK_alpha
PANTHERiPTHR22988:SF31, PTHR22988:SF31, 1 hit
PfamiView protein in Pfam
PF00130, C1_1, 1 hit
PF00780, CNH, 1 hit
PF08826, DMPK_coil, 1 hit
PF15796, KELK, 1 hit
PF00069, Pkinase, 1 hit
PF00433, Pkinase_C, 1 hit
SMARTiView protein in SMART
SM00109, C1, 1 hit
SM00036, CNH, 1 hit
SM00285, PBD, 1 hit
SM00233, PH, 1 hit
SM00133, S_TK_X, 1 hit
SM00220, S_TKc, 1 hit
SUPFAMiSSF56112, SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS51285, AGC_KINASE_CTER, 1 hit
PS50219, CNH, 1 hit
PS50108, CRIB, 1 hit
PS50003, PH_DOMAIN, 1 hit
PS00107, PROTEIN_KINASE_ATP, 1 hit
PS50011, PROTEIN_KINASE_DOM, 1 hit
PS00108, PROTEIN_KINASE_ST, 1 hit
PS00479, ZF_DAG_PE_1, 1 hit
PS50081, ZF_DAG_PE_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMRCKA_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5VT25
Secondary accession number(s): O75039
, Q59GZ1, Q5H9N9, Q5T797, Q5VT26, Q5VT27, Q86XX2, Q86XX3, Q99646
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 8, 2005
Last sequence update: December 7, 2004
Last modified: August 12, 2020
This is version 159 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. SIMILARITY comments
    Index of protein domains and families
  5. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  6. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again