Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 135 (16 Jan 2019)
Sequence version 2 (21 Mar 2012)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Mesoderm induction early response protein 1

Gene

Mier1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcriptional repressor regulating the expression of a number of genes including SP1 target genes. Probably functions through recruitment of HDAC1 a histone deacetylase involved in chromatin silencing.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRepressor
Biological processTranscription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Mesoderm induction early response protein 1
Short name:
Early response 1
Short name:
Er1
Short name:
Mi-er1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Mier1
Synonyms:Kiaa1610
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1918398 Mier1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001971421 – 511Mesoderm induction early response protein 1Add BLAST511

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei10PhosphoserineBy similarity1
Modified residuei140PhosphoserineBy similarity1
Modified residuei154PhosphotyrosineBy similarity1
Modified residuei159PhosphoserineCombined sources1
Modified residuei165PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki238Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei366PhosphoserineBy similarity1
Modified residuei368PhosphoserineBy similarity1
Modified residuei376PhosphoserineCombined sources1
Cross-linki419Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei482PhosphoserineCombined sources1
Modified residuei487PhosphoserineCombined sources1
Modified residuei490PhosphoserineBy similarity1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5UAK0

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q5UAK0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5UAK0

PeptideAtlas

More...
PeptideAtlasi
Q5UAK0

PRoteomics IDEntifications database

More...
PRIDEi
Q5UAK0

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5UAK0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5UAK0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed. Isoform 1 is only expressed in testis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000028522 Expressed in 246 organ(s), highest expression level in dorsal pancreas

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5UAK0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5UAK0 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with HDAC1. Part of a complex containing at least CDYL, MIER1, MIER2, HDAC1 and HDAC2.By similarity

GO - Molecular functioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q5UAK0, 1 interactor

Molecular INTeraction database

More...
MINTi
Q5UAK0

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000030247

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q5UAK0

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q5UAK0

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini179 – 277ELM2PROSITE-ProRule annotationAdd BLAST99
Domaini282 – 334SANTPROSITE-ProRule annotationAdd BLAST53

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi36 – 296Glu-richAdd BLAST261

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4329 Eukaryota
ENOG410Y9DJ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153839

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG052923

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5UAK0

Identification of Orthologs from Complete Genome Data

More...
OMAi
DCELFER

Database of Orthologous Groups

More...
OrthoDBi
1062529at2759

TreeFam database of animal gene trees

More...
TreeFami
TF106453

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000949 ELM2_dom
IPR009057 Homeobox-like_sf
IPR040138 MIER/MTA
IPR031169 MIER1
IPR001005 SANT/Myb
IPR017884 SANT_dom

The PANTHER Classification System

More...
PANTHERi
PTHR10865 PTHR10865, 1 hit
PTHR10865:SF24 PTHR10865:SF24, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01448 ELM2, 1 hit
PF00249 Myb_DNA-binding, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01189 ELM2, 1 hit
SM00717 SANT, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46689 SSF46689, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51156 ELM2, 1 hit
PS51293 SANT, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 3 (identifier: Q5UAK0-3) [UniParc]FASTAAdd to basket
Also known as: N3 beta

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEPSVESSS PGGSATSEDH EFDPSADMLV HDFDDERTLE EEEMMEGETN
60 70 80 90 100
FSSEIEDLAR EGDMPIHELL SLYGYDSTVR LPEEEEEEEE EEEGEDDEDA
110 120 130 140 150
DNDDNSGCSG ENKEENIKDS SGQEDETQSS NDDPSQSVTS QDAQEIIRPR
160 170 180 190 200
RCKYFDTNSE IEEESEEDED YIPSEDWKKE IMVGSMFQAE IPVGVCRYKE
210 220 230 240 250
NEKVYENDDQ LLWDPECLPE EKVVVFLKDA SRRTGDEKGV EAIPEGSHIK
260 270 280 290 300
DNEQALYELV KCSFDTEEAL RRLRFNVKAA REELSVWTEE ECRNFEQGLK
310 320 330 340 350
AYGKDFHLIQ ANKVRTRSVG ECVAFYYMWK KSERYDFFAQ QTRFGKKKYN
360 370 380 390 400
LHPGVTDYMD RLLDESESAA SSRAPSPPPT ASNSSNSQSE KEDGAVSSRN
410 420 430 440 450
QNGVSSNGPG EILNKEEVKV EGLHVNGPTG GNKKPLLTDM DTNGYEANNL
460 470 480 490 500
TTDPKLAHMT ARNENDFDEK NERPAKRRRI NSSGKESPGS SEFFQEAVSH
510
GKFEEHENTN D
Length:511
Mass (Da):57,908
Last modified:March 21, 2012 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i144FBD1A575A557F
GO
Isoform 1 (identifier: Q5UAK0-1) [UniParc]FASTAAdd to basket
Also known as: N4 beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MAEPSVESSSP → MCIRCLCLIGLQTVSGFFSCQITSHLLSLQVQGEYKCGLLCENTSLLIANVRRKVS

Show »
Length:556
Mass (Da):62,980
Checksum:iE2DC03D0C8E06171
GO
Isoform 2 (identifier: Q5UAK0-2) [UniParc]FASTAAdd to basket
Also known as: N1 beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MAE → MFMFNWFTDCLWILFLSNYK

Show »
Length:528
Mass (Da):60,179
Checksum:iA969DB86E9AA82ED
GO
Isoform 4 (identifier: Q5UAK0-4) [UniParc]FASTAAdd to basket
Also known as: N2 beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MAE → ML

Show »
Length:510
Mass (Da):57,821
Checksum:iF0BFBD1A54F81666
GO
Isoform 5 (identifier: Q5UAK0-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-181: Missing.

Show »
Length:330
Mass (Da):37,354
Checksum:i0DB7C93B773B8500
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1AY31B1AY31_MOUSE
Mesoderm induction early response p...
Mier1
28Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AY30B1AY30_MOUSE
Mesoderm induction early response p...
Mier1
15Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC98215 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0161741 – 181Missing in isoform 5. 1 PublicationAdd BLAST181
Alternative sequenceiVSP_0424541 – 11MAEPSVESSSP → MCIRCLCLIGLQTVSGFFSC QITSHLLSLQVQGEYKCGLL CENTSLLIANVRRKVS in isoform 1. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_0161751 – 3MAE → MFMFNWFTDCLWILFLSNYK in isoform 2. 2 Publications3
Alternative sequenceiVSP_0161771 – 3MAE → ML in isoform 4. 2 Publications3

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY769435 mRNA Translation: AAV37181.1
AY769436 mRNA Translation: AAV37182.1
AY769437 mRNA Translation: AAV37183.1
AY769438 mRNA Translation: AAV37184.1
AK129405 mRNA Translation: BAC98215.1 Different initiation.
AK016915 mRNA Translation: BAB30493.1
AL844176 Genomic DNA No translation available.
BC130227 mRNA Translation: AAI30228.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS18408.1 [Q5UAK0-2]
CCDS38825.1 [Q5UAK0-3]
CCDS71432.1 [Q5UAK0-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001034170.1, NM_001039081.2 [Q5UAK0-3]
NP_001273150.1, NM_001286221.1 [Q5UAK0-1]
NP_001273151.1, NM_001286222.1 [Q5UAK0-2]
NP_001273152.1, NM_001286223.1 [Q5UAK0-4]
NP_081972.2, NM_027696.3 [Q5UAK0-2]
XP_006503464.1, XM_006503401.3 [Q5UAK0-2]
XP_006503465.1, XM_006503402.1 [Q5UAK0-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.288721

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000030247; ENSMUSP00000030247; ENSMUSG00000028522 [Q5UAK0-2]
ENSMUST00000097945; ENSMUSP00000095558; ENSMUSG00000028522 [Q5UAK0-1]
ENSMUST00000106855; ENSMUSP00000102468; ENSMUSG00000028522 [Q5UAK0-5]
ENSMUST00000106857; ENSMUSP00000102470; ENSMUSG00000028522 [Q5UAK0-3]
ENSMUST00000106858; ENSMUSP00000102471; ENSMUSG00000028522 [Q5UAK0-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
71148

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:71148

UCSC genome browser

More...
UCSCi
uc008txd.2 mouse [Q5UAK0-2]
uc008txf.2 mouse [Q5UAK0-4]
uc008txi.2 mouse [Q5UAK0-3]
uc012dhr.2 mouse [Q5UAK0-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY769435 mRNA Translation: AAV37181.1
AY769436 mRNA Translation: AAV37182.1
AY769437 mRNA Translation: AAV37183.1
AY769438 mRNA Translation: AAV37184.1
AK129405 mRNA Translation: BAC98215.1 Different initiation.
AK016915 mRNA Translation: BAB30493.1
AL844176 Genomic DNA No translation available.
BC130227 mRNA Translation: AAI30228.1
CCDSiCCDS18408.1 [Q5UAK0-2]
CCDS38825.1 [Q5UAK0-3]
CCDS71432.1 [Q5UAK0-1]
RefSeqiNP_001034170.1, NM_001039081.2 [Q5UAK0-3]
NP_001273150.1, NM_001286221.1 [Q5UAK0-1]
NP_001273151.1, NM_001286222.1 [Q5UAK0-2]
NP_001273152.1, NM_001286223.1 [Q5UAK0-4]
NP_081972.2, NM_027696.3 [Q5UAK0-2]
XP_006503464.1, XM_006503401.3 [Q5UAK0-2]
XP_006503465.1, XM_006503402.1 [Q5UAK0-2]
UniGeneiMm.288721

3D structure databases

ProteinModelPortaliQ5UAK0
SMRiQ5UAK0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ5UAK0, 1 interactor
MINTiQ5UAK0
STRINGi10090.ENSMUSP00000030247

PTM databases

iPTMnetiQ5UAK0
PhosphoSitePlusiQ5UAK0

Proteomic databases

jPOSTiQ5UAK0
MaxQBiQ5UAK0
PaxDbiQ5UAK0
PeptideAtlasiQ5UAK0
PRIDEiQ5UAK0

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000030247; ENSMUSP00000030247; ENSMUSG00000028522 [Q5UAK0-2]
ENSMUST00000097945; ENSMUSP00000095558; ENSMUSG00000028522 [Q5UAK0-1]
ENSMUST00000106855; ENSMUSP00000102468; ENSMUSG00000028522 [Q5UAK0-5]
ENSMUST00000106857; ENSMUSP00000102470; ENSMUSG00000028522 [Q5UAK0-3]
ENSMUST00000106858; ENSMUSP00000102471; ENSMUSG00000028522 [Q5UAK0-2]
GeneIDi71148
KEGGimmu:71148
UCSCiuc008txd.2 mouse [Q5UAK0-2]
uc008txf.2 mouse [Q5UAK0-4]
uc008txi.2 mouse [Q5UAK0-3]
uc012dhr.2 mouse [Q5UAK0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57708
MGIiMGI:1918398 Mier1

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG4329 Eukaryota
ENOG410Y9DJ LUCA
GeneTreeiENSGT00940000153839
HOVERGENiHBG052923
InParanoidiQ5UAK0
OMAiDCELFER
OrthoDBi1062529at2759
TreeFamiTF106453

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q5UAK0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000028522 Expressed in 246 organ(s), highest expression level in dorsal pancreas
ExpressionAtlasiQ5UAK0 baseline and differential
GenevisibleiQ5UAK0 MM

Family and domain databases

InterProiView protein in InterPro
IPR000949 ELM2_dom
IPR009057 Homeobox-like_sf
IPR040138 MIER/MTA
IPR031169 MIER1
IPR001005 SANT/Myb
IPR017884 SANT_dom
PANTHERiPTHR10865 PTHR10865, 1 hit
PTHR10865:SF24 PTHR10865:SF24, 1 hit
PfamiView protein in Pfam
PF01448 ELM2, 1 hit
PF00249 Myb_DNA-binding, 1 hit
SMARTiView protein in SMART
SM01189 ELM2, 1 hit
SM00717 SANT, 1 hit
SUPFAMiSSF46689 SSF46689, 1 hit
PROSITEiView protein in PROSITE
PS51156 ELM2, 1 hit
PS51293 SANT, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMIER1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5UAK0
Secondary accession number(s): A1L3P9
, B1AY29, B1AY34, Q5UAK1, Q5UAK2, Q5UAK3, Q6ZPL6, Q9D402
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 22, 2005
Last sequence update: March 21, 2012
Last modified: January 16, 2019
This is version 135 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again