Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 128 (13 Feb 2019)
Sequence version 1 (21 Dec 2004)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

5'-nucleotidase domain-containing protein 1

Gene

NT5DC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei16NucleophileBy similarity1
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi16MagnesiumBy similarity1
Active sitei18Proton donorBy similarity1
Metal bindingi18Magnesium; via carbonyl oxygenBy similarity1
Metal bindingi313MagnesiumBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • 5'-nucleotidase activity Source: GO_Central
  • metal ion binding Source: UniProtKB-KW

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase
LigandMagnesium, Metal-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
5'-nucleotidase domain-containing protein 1 (EC:3.1.3.-)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NT5DC1
Synonyms:NT5C2L1
ORF Names:LP2642
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000178425.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:21556 NT5DC1

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5TFE4

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
221294

Open Targets

More...
OpenTargetsi
ENSG00000178425

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134892962

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NT5DC1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74746390

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002472221 – 4555'-nucleotidase domain-containing protein 1Add BLAST455

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei171N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q5TFE4

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5TFE4

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q5TFE4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5TFE4

PeptideAtlas

More...
PeptideAtlasi
Q5TFE4

PRoteomics IDEntifications database

More...
PRIDEi
Q5TFE4

ProteomicsDB human proteome resource

More...
ProteomicsDBi
65082

PTM databases

DEPOD human dephosphorylation database

More...
DEPODi
Q5TFE4

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5TFE4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5TFE4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000178425 Expressed in 203 organ(s), highest expression level in corpus callosum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5TFE4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5TFE4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA030352

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
128704, 8 interactors

Protein interaction database and analysis system

More...
IntActi
Q5TFE4, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000326858

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q5TFE4

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q5TFE4

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2469 Eukaryota
ENOG410XQAV LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155676

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000054218

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG058689

Identification of Orthologs from Complete Genome Data

More...
OMAi
YDCIGFD

Database of Orthologous Groups

More...
OrthoDBi
875136at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5TFE4

TreeFam database of animal gene trees

More...
TreeFami
TF325912

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.1000, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036412 HAD-like_sf
IPR008380 HAD-SF_hydro_IG_5-nucl
IPR023214 HAD_sf

The PANTHER Classification System

More...
PANTHERi
PTHR12103 PTHR12103, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF05761 5_nucleotid, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56784 SSF56784, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5TFE4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAQHFSLAAC DVVGFDLDHT LCRYNLPESA PLIYNSFAQF LVKEKGYDKE
60 70 80 90 100
LLNVTPEDWD FCCKGLALDL EDGNFLKLAN NGTVLRASHG TKMMTPEVLA
110 120 130 140 150
EAYGKKEWKH FLSDTGMACR SGKYYFYDNY FDLPGALLCA RVVDYLTKLN
160 170 180 190 200
NGQKTFDFWK DIVAAIQHNY KMSAFKENCG IYFPEIKRDP GRYLHSCPES
210 220 230 240 250
VKKWLRQLKN AGKILLLITS SHSDYCRLLC EYILGNDFTD LFDIVITNAL
260 270 280 290 300
KPGFFSHLPS QRPFRTLEND EEQEALPSLD KPGWYSQGNA VHLYELLKKM
310 320 330 340 350
TGKPEPKVVY FGDSMHSDIF PARHYSNWET VLILEELRGD EGTRSQRPEE
360 370 380 390 400
SEPLEKKGKY EGPKAKPLNT SSKKWGSFFI DSVLGLENTE DSLVYTWSCK
410 420 430 440 450
RISTYSTIAI PSIEAIAELP LDYKFTRFSS SNSKTAGYYP NPPLVLSSDE

TLISK
Length:455
Mass (Da):51,845
Last modified:December 21, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1FFE79D4FD8DA236
GO
Isoform 2 (identifier: Q5TFE4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-85: MAQHFSLAAC...LKLANNGTVL → MFLLAPVATGINSHNDRGRGIQGTINEQCASSLKI

Note: No experimental confirmation available.
Show »
Length:405
Mass (Da):46,027
Checksum:i702E38FFD0537FD8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5QPD0Q5QPD0_HUMAN
5'-nucleotidase domain-containing p...
NT5DC1
195Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YDA5H0YDA5_HUMAN
5'-nucleotidase domain-containing p...
NT5DC1
141Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAP34458 differs from that shown. Reason: Frameshift at position 339.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0542361 – 85MAQHF…NGTVL → MFLLAPVATGINSHNDRGRG IQGTINEQCASSLKI in isoform 2. 1 PublicationAdd BLAST85

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK090918 mRNA Translation: BAG52247.1
AL050331 Genomic DNA No translation available.
AL121963 Genomic DNA No translation available.
CH471051 Genomic DNA Translation: EAW48237.1
CH471051 Genomic DNA Translation: EAW48239.1
BC108699 mRNA Translation: AAI08700.1
BC136832 mRNA Translation: AAI36833.1
BC136841 mRNA Translation: AAI36842.1
AY203935 mRNA Translation: AAP34458.1 Frameshift.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS5104.1 [Q5TFE4-1]

NCBI Reference Sequences

More...
RefSeqi
NP_689942.2, NM_152729.2 [Q5TFE4-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.520341

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000319550; ENSP00000326858; ENSG00000178425 [Q5TFE4-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
221294

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:221294

UCSC genome browser

More...
UCSCi
uc003pwj.4 human [Q5TFE4-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK090918 mRNA Translation: BAG52247.1
AL050331 Genomic DNA No translation available.
AL121963 Genomic DNA No translation available.
CH471051 Genomic DNA Translation: EAW48237.1
CH471051 Genomic DNA Translation: EAW48239.1
BC108699 mRNA Translation: AAI08700.1
BC136832 mRNA Translation: AAI36833.1
BC136841 mRNA Translation: AAI36842.1
AY203935 mRNA Translation: AAP34458.1 Frameshift.
CCDSiCCDS5104.1 [Q5TFE4-1]
RefSeqiNP_689942.2, NM_152729.2 [Q5TFE4-1]
UniGeneiHs.520341

3D structure databases

ProteinModelPortaliQ5TFE4
SMRiQ5TFE4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128704, 8 interactors
IntActiQ5TFE4, 1 interactor
STRINGi9606.ENSP00000326858

PTM databases

DEPODiQ5TFE4
iPTMnetiQ5TFE4
PhosphoSitePlusiQ5TFE4

Polymorphism and mutation databases

BioMutaiNT5DC1
DMDMi74746390

Proteomic databases

EPDiQ5TFE4
jPOSTiQ5TFE4
MaxQBiQ5TFE4
PaxDbiQ5TFE4
PeptideAtlasiQ5TFE4
PRIDEiQ5TFE4
ProteomicsDBi65082

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
221294
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000319550; ENSP00000326858; ENSG00000178425 [Q5TFE4-1]
GeneIDi221294
KEGGihsa:221294
UCSCiuc003pwj.4 human [Q5TFE4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
221294
DisGeNETi221294
EuPathDBiHostDB:ENSG00000178425.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NT5DC1
HGNCiHGNC:21556 NT5DC1
HPAiHPA030352
neXtProtiNX_Q5TFE4
OpenTargetsiENSG00000178425
PharmGKBiPA134892962

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2469 Eukaryota
ENOG410XQAV LUCA
GeneTreeiENSGT00940000155676
HOGENOMiHOG000054218
HOVERGENiHBG058689
OMAiYDCIGFD
OrthoDBi875136at2759
PhylomeDBiQ5TFE4
TreeFamiTF325912

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NT5DC1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
221294

Protein Ontology

More...
PROi
PR:Q5TFE4

Gene expression databases

BgeeiENSG00000178425 Expressed in 203 organ(s), highest expression level in corpus callosum
ExpressionAtlasiQ5TFE4 baseline and differential
GenevisibleiQ5TFE4 HS

Family and domain databases

Gene3Di3.40.50.1000, 1 hit
InterProiView protein in InterPro
IPR036412 HAD-like_sf
IPR008380 HAD-SF_hydro_IG_5-nucl
IPR023214 HAD_sf
PANTHERiPTHR12103 PTHR12103, 1 hit
PfamiView protein in Pfam
PF05761 5_nucleotid, 1 hit
SUPFAMiSSF56784 SSF56784, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNT5D1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5TFE4
Secondary accession number(s): B2RND9, B3KR35, Q6XYD5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: December 21, 2004
Last modified: February 13, 2019
This is version 128 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again