Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 117 (31 Jul 2019)
Sequence version 1 (21 Dec 2004)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Lengsin

Gene

LGSN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May act as a component of the cytoskeleton or as a chaperone for the reorganization of intermediate filament proteins during terminal differentiation in the lens. Does not seem to have enzymatic activity (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Lengsin
Alternative name(s):
Glutamate-ammonia ligase domain-containing protein 1
Lens glutamine synthase-like
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LGSN
Synonyms:GLULD1, LGS
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:21016 LGSN

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611470 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5TDP6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
51557

Open Targets

More...
OpenTargetsi
ENSG00000146166

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164722103

Chemistry databases

Drug and drug target database

More...
DrugBanki
DB00142 L-Glutamic Acid

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
LGSN

Domain mapping of disease mutations (DMDM)

More...
DMDMi
67465079

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001532821 – 509LengsinAdd BLAST509

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5TDP6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5TDP6

PeptideAtlas

More...
PeptideAtlasi
Q5TDP6

PRoteomics IDEntifications database

More...
PRIDEi
Q5TDP6

ProteomicsDB human proteome resource

More...
ProteomicsDBi
65029 [Q5TDP6-1]
65030 [Q5TDP6-2]
65031 [Q5TDP6-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5TDP6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5TDP6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Abundantly expressed in lens.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000146166 Expressed in 41 organ(s), highest expression level in buccal mucosa cell

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5TDP6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5TDP6 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA030957
HPA039983

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Dodecamer.

Interacts with BFSP2 AND VIM (By similarity).

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119608, 1 interactor

Protein interaction database and analysis system

More...
IntActi
Q5TDP6, 2 interactors

Molecular INTeraction database

More...
MINTi
Q5TDP6

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000359691

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q5TDP6

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the glutamine synthetase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0683 Eukaryota
COG0174 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000013639

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000113321

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5TDP6

Identification of Orthologs from Complete Genome Data

More...
OMAi
TFYTHPE

Database of Orthologous Groups

More...
OrthoDBi
1424442at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5TDP6

TreeFam database of animal gene trees

More...
TreeFami
TF331605

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.10.20.70, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036651 Gln_synt_N
IPR014746 Gln_synth/guanido_kin_cat_dom
IPR008146 Gln_synth_cat_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00120 Gln-synt_C, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01230 Gln-synt_C, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54368 SSF54368, 1 hit
SSF55931 SSF55931, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5TDP6-1) [UniParc]FASTAAdd to basket
Also known as: LGS_v2

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNNEEDLLQE DSTRDEGNET EANSMNTLRR TRKKVTKPYV CSTEVGETDM
60 70 80 90 100
SNSNDCMRDS SQILTPPQLS SRMKHIRQAM AKNRLQFVRF EATDLHGVSR
110 120 130 140 150
SKTIPAHFFQ EKVSHGVCMP RGYLEVIPNP KDNEMNNIRA TCFNSDIVLM
160 170 180 190 200
PELSTFRVLP WADRTARVIC DTFTVTGEPL LTSPRYIAKR QLSHLQASGF
210 220 230 240 250
SLLSAFIYDF CIFGVPEILN SKIISFPALT FLNNHDQPFM QELVDGLYHT
260 270 280 290 300
GANVESFSSS TRPGQMEISF LPEFGISSAD NAFTLRTGVK EVARKYNYIA
310 320 330 340 350
SFFIETGFCD SGILSHSLWD VDRKKNMFCS TSGTEQLTIT GKKWLAGLLK
360 370 380 390 400
HSAALSCLMA PSVSCRKRYS KDRKDLKKSV PTTWGYNDNS CIFNIKCHGE
410 420 430 440 450
KGTRIENKLG SATANPYLVL AATVAAGLDG LHSSNEVLAG PDESTDFYQV
460 470 480 490 500
EPSEIPLKLE DALVALEEDQ CLRQALGETF IRYFVAMKKY ELENEEIAAE

RNKFLEYFI
Length:509
Mass (Da):57,278
Last modified:December 21, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i86ACAC50866121BB
GO
Isoform 2 (identifier: Q5TDP6-2) [UniParc]FASTAAdd to basket
Also known as: LGS_v1

The sequence of this isoform differs from the canonical sequence as follows:
     177-208: GEPLLTSPRYIAKRQLSHLQASGFSLLSAFIY → VSGMSIGRKTCSAALLELSSSRSLGKNGWQDS
     209-509: Missing.

Show »
Length:208
Mass (Da):23,471
Checksum:i4CAA3FB3F7E13E82
GO
Isoform 3 (identifier: Q5TDP6-3) [UniParc]FASTAAdd to basket
Also known as: LGS_v3

The sequence of this isoform differs from the canonical sequence as follows:
     55-118: DCMRDSSQIL...FQEKVSHGVC → ERIRNQMVCH...PGGEFNPNSE
     119-509: Missing.

Show »
Length:118
Mass (Da):13,175
Checksum:i28AC9954C429235B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MTD2A0A0A0MTD2_HUMAN
Lengsin
LGSN
191Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti81A → S in ABG75902 (PubMed:17010935).Curated1
Sequence conflicti472L → Q in AAF61255 (PubMed:12107413).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05455226N → Y. Corresponds to variant dbSNP:rs2459568Ensembl.1
Natural variantiVAR_05455346G → E. Corresponds to variant dbSNP:rs35691434Ensembl.1
Natural variantiVAR_054554137N → H. Corresponds to variant dbSNP:rs6454127Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_03648055 – 118DCMRD…SHGVC → ERIRNQMVCHKLGNTSKPIM GPGSAESHLSYDDKDSQDET TVIKPLPPRTTTNVPGGEFN PNSE in isoform 3. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_036481119 – 509Missing in isoform 3. 1 PublicationAdd BLAST391
Alternative sequenceiVSP_036482177 – 208GEPLL…SAFIY → VSGMSIGRKTCSAALLELSS SRSLGKNGWQDS in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_036483209 – 509Missing in isoform 2. 1 PublicationAdd BLAST301

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
DQ682605 mRNA Translation: ABG75902.1
DQ682606 mRNA Translation: ABG75903.1
AF242388 mRNA Translation: AAF61255.1
AL121949 Genomic DNA No translation available.
AL590456 Genomic DNA No translation available.
CH471143 Genomic DNA Translation: EAW88493.1
BC130366 mRNA Translation: AAI30367.1
BC130368 mRNA Translation: AAI30369.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS4964.1 [Q5TDP6-1]
CCDS55027.1 [Q5TDP6-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001137412.1, NM_001143940.1 [Q5TDP6-2]
NP_057655.2, NM_016571.2 [Q5TDP6-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000370657; ENSP00000359691; ENSG00000146166 [Q5TDP6-1]
ENST00000370658; ENSP00000359692; ENSG00000146166 [Q5TDP6-2]
ENST00000622415; ENSP00000479173; ENSG00000146166 [Q5TDP6-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51557

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51557

UCSC genome browser

More...
UCSCi
uc003peh.4 human [Q5TDP6-1]

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ682605 mRNA Translation: ABG75902.1
DQ682606 mRNA Translation: ABG75903.1
AF242388 mRNA Translation: AAF61255.1
AL121949 Genomic DNA No translation available.
AL590456 Genomic DNA No translation available.
CH471143 Genomic DNA Translation: EAW88493.1
BC130366 mRNA Translation: AAI30367.1
BC130368 mRNA Translation: AAI30369.1
CCDSiCCDS4964.1 [Q5TDP6-1]
CCDS55027.1 [Q5TDP6-2]
RefSeqiNP_001137412.1, NM_001143940.1 [Q5TDP6-2]
NP_057655.2, NM_016571.2 [Q5TDP6-1]

3D structure databases

SMRiQ5TDP6
ModBaseiSearch...

Protein-protein interaction databases

BioGridi119608, 1 interactor
IntActiQ5TDP6, 2 interactors
MINTiQ5TDP6
STRINGi9606.ENSP00000359691

Chemistry databases

DrugBankiDB00142 L-Glutamic Acid

PTM databases

iPTMnetiQ5TDP6
PhosphoSitePlusiQ5TDP6

Polymorphism and mutation databases

BioMutaiLGSN
DMDMi67465079

Proteomic databases

jPOSTiQ5TDP6
PaxDbiQ5TDP6
PeptideAtlasiQ5TDP6
PRIDEiQ5TDP6
ProteomicsDBi65029 [Q5TDP6-1]
65030 [Q5TDP6-2]
65031 [Q5TDP6-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000370657; ENSP00000359691; ENSG00000146166 [Q5TDP6-1]
ENST00000370658; ENSP00000359692; ENSG00000146166 [Q5TDP6-2]
ENST00000622415; ENSP00000479173; ENSG00000146166 [Q5TDP6-3]
GeneIDi51557
KEGGihsa:51557
UCSCiuc003peh.4 human [Q5TDP6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51557
DisGeNETi51557

GeneCards: human genes, protein and diseases

More...
GeneCardsi
LGSN
HGNCiHGNC:21016 LGSN
HPAiHPA030957
HPA039983
MIMi611470 gene
neXtProtiNX_Q5TDP6
OpenTargetsiENSG00000146166
PharmGKBiPA164722103

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0683 Eukaryota
COG0174 LUCA
GeneTreeiENSGT00390000013639
HOGENOMiHOG000113321
InParanoidiQ5TDP6
OMAiTFYTHPE
OrthoDBi1424442at2759
PhylomeDBiQ5TDP6
TreeFamiTF331605

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
LGSN human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51557

Protein Ontology

More...
PROi
PR:Q5TDP6

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000146166 Expressed in 41 organ(s), highest expression level in buccal mucosa cell
ExpressionAtlasiQ5TDP6 baseline and differential
GenevisibleiQ5TDP6 HS

Family and domain databases

Gene3Di3.10.20.70, 1 hit
InterProiView protein in InterPro
IPR036651 Gln_synt_N
IPR014746 Gln_synth/guanido_kin_cat_dom
IPR008146 Gln_synth_cat_dom
PfamiView protein in Pfam
PF00120 Gln-synt_C, 1 hit
SMARTiView protein in SMART
SM01230 Gln-synt_C, 1 hit
SUPFAMiSSF54368 SSF54368, 1 hit
SSF55931 SSF55931, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLGSN_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5TDP6
Secondary accession number(s): A1L421
, Q0PVN9, Q0PVP0, Q9NYJ0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 2005
Last sequence update: December 21, 2004
Last modified: July 31, 2019
This is version 117 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again