Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 141 (13 Feb 2019)
Sequence version 1 (21 Dec 2004)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

DDB1- and CUL4-associated factor 8

Gene

DCAF8

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processUbl conjugation pathway

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8951664 Neddylation

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q5TAQ9

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00143

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
DDB1- and CUL4-associated factor 8
Alternative name(s):
WD repeat-containing protein 42A
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DCAF8
Synonyms:H326, WDR42A
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000132716.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24891 DCAF8

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
615820 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5TAQ9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Giant axonal neuropathy 2, autosomal dominant (GAN2)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal dominant peripheral axonal neuropathy characterized by onset of distal sensory impairment with lower extremity muscle weakness and atrophy after the second decade. Clinical features include foot deformities apparent in childhood, and cardiomyopathy in severely affected individuals. Sural nerve biopsy shows giant axonal swelling with neurofilament accumulation.
See also OMIM:610100
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_071265317R → C in GAN2; interaction with DDB1 is decreased. 1 PublicationCorresponds to variant dbSNP:rs587777425EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi39 – 50IEVEA…LSLSL → AEVEASDASASA: Abrogates cytoplasmic localization. 1 PublicationAdd BLAST12
Mutagenesisi115 – 122RRRVQRKR → AAAVQAKA: Abrogates nuclear localization. 1 Publication8
Mutagenesisi314R → A: Reduces association with DDB1. 1 Publication1
Mutagenesisi362R → A: Reduces association with DDB1. 1 Publication1

Keywords - Diseasei

Disease mutation, Neurodegeneration, Neuropathy

Organism-specific databases

DisGeNET

More...
DisGeNETi
50717

MalaCards human disease database

More...
MalaCardsi
DCAF8
MIMi610100 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000132716

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
401964 Autosomal dominant Charcot-Marie-Tooth disease type 2 with giant axons

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA165751195

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DCAF8

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74756455

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002969571 – 597DDB1- and CUL4-associated factor 8Add BLAST597

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei21PhosphoserineBy similarity1
Modified residuei22PhosphoserineBy similarity1
Modified residuei99PhosphoserineBy similarity1
Modified residuei129PhosphoserineBy similarity1
Modified residuei130PhosphoserineBy similarity1
Modified residuei204Omega-N-methylarginine; by PRMT11 Publication1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q5TAQ9

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5TAQ9

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q5TAQ9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5TAQ9

PeptideAtlas

More...
PeptideAtlasi
Q5TAQ9

PRoteomics IDEntifications database

More...
PRIDEi
Q5TAQ9

ProteomicsDB human proteome resource

More...
ProteomicsDBi
64861
64862 [Q5TAQ9-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5TAQ9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5TAQ9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000132716 Expressed in 232 organ(s), highest expression level in left lobe of thyroid gland

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5TAQ9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5TAQ9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA027218
HPA027381

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with DDB1, CUL4A and CUL4B. Interacts with KPNA1, KPNB1 and XPO1.3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119121, 73 interactors

Database of interacting proteins

More...
DIPi
DIP-48762N

Protein interaction database and analysis system

More...
IntActi
Q5TAQ9, 19 interactors

Molecular INTeraction database

More...
MINTi
Q5TAQ9

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000451235

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1597
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3I8EX-ray3.40C/D153-165[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q5TAQ9

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q5TAQ9

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q5TAQ9

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati191 – 230WD 1Add BLAST40
Repeati234 – 275WD 2Add BLAST42
Repeati281 – 321WD 3Add BLAST41
Repeati329 – 369WD 4Add BLAST41
Repeati385 – 424WD 5Add BLAST40
Repeati432 – 472WD 6Add BLAST41
Repeati476 – 515WD 7Add BLAST40

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi39 – 50Nuclear export signal1 PublicationAdd BLAST12
Motifi114 – 122Nuclear localization signal1 Publication9

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the WD repeat DCAF8 family.Curated

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1334 Eukaryota
KOG3133 Eukaryota
ENOG410XQZP LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000062951

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG053807

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5TAQ9

KEGG Orthology (KO)

More...
KOi
K11804

Database of Orthologous Groups

More...
OrthoDBi
1270484at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5TAQ9

TreeFam database of animal gene trees

More...
TreeFami
TF326071

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00400 WD40, 3 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00320 WD40, 7 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50978 SSF50978, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50082 WD_REPEATS_2, 1 hit
PS50294 WD_REPEATS_REGION, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5TAQ9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSKGSSTDG RTDLANGSLS SSPEEMSGAE EGRETSSGIE VEASDLSLSL
60 70 80 90 100
TGDDGGPNRT STESRGTDTE SSGEDKDSDS MEDTGHYSIN DENRVHDRSE
110 120 130 140 150
EEEEEEEEEE EEQPRRRVQR KRANRDQDSS DDERALEDWV SSETSALPRP
160 170 180 190 200
RWQALPALRE RELGSSARFV YEACGARVFV QRFRLQHGLE GHTGCVNTLH
210 220 230 240 250
FNQRGTWLAS GSDDLKVVVW DWVRRQPVLD FESGHKSNVF QAKFLPNSGD
260 270 280 290 300
STLAMCARDG QVRVAELSAT QCCKNTKRVA QHKGASHKLA LEPDSPCTFL
310 320 330 340 350
SAGEDAVVFT IDLRQDRPAS KLVVTKEKEK KVGLYTIYVN PANTHQFAVG
360 370 380 390 400
GRDQFVRIYD QRKIDENENN GVLKKFCPHH LVNSESKANI TCLVYSHDGT
410 420 430 440 450
ELLASYNDED IYLFNSSHSD GAQYVKRYKG HRNNATVKGV NFYGPKSEFV
460 470 480 490 500
VSGSDCGHIF LWEKSSCQII QFMEGDKGGV VNCLEPHPHL PVLATSGLDH
510 520 530 540 550
DVKIWAPTAE ASTELTGLKD VIKKNKRERD EDSLHQTDLF DSHMLWFLMH
560 570 580 590
HLRQRRHHRR WREPGVGATD ADSDESPSSS DTSDEEEGPD RVQCMPS
Length:597
Mass (Da):66,852
Last modified:December 21, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3F3396C77EA1E3AD
GO
Isoform 2 (identifier: Q5TAQ9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     242-273: AKFLPNSGDSTLAMCARDGQVRVAELSATQCC → VRQGSIIATERIRHELEKSELQHGLGADSELL
     274-597: Missing.

Note: No experimental confirmation available.
Show »
Length:273
Mass (Da):30,569
Checksum:i160E9D57D87F6B51
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5TAQ8Q5TAQ8_HUMAN
DDB1- and CUL4-associated factor 8
DCAF8
212Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GYQ9V9GYQ9_HUMAN
DDB1- and CUL4-associated factor 8
DCAF8
125Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GY54V9GY54_HUMAN
DDB1- and CUL4-associated factor 8
DCAF8
417Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5TAQ5Q5TAQ5_HUMAN
DDB1- and CUL4-associated factor 8
DCAF8
109Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GYZ9V9GYZ9_HUMAN
DDB1- and CUL4-associated factor 8
DCAF8
109Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GZ39V9GZ39_HUMAN
DDB1- and CUL4-associated factor 8
DCAF8
66Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5TAQ7Q5TAQ7_HUMAN
DDB1- and CUL4-associated factor 8
DCAF8
106Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GY98V9GY98_HUMAN
DDB1- and CUL4-associated factor 8
DCAF8
81Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5TAQ6Q5TAQ6_HUMAN
DDB1- and CUL4-associated factor 8
DCAF8
40Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAA16607 differs from that shown. Reason: Frameshift at positions 117 and 123.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti68D → E in AAH13107 (PubMed:15489334).Curated1
Sequence conflicti123A → T in AAH98271 (PubMed:15489334).Curated1
Sequence conflicti155L → F in CAH18661 (PubMed:17974005).Curated1
Sequence conflicti181 – 182QR → HG in AAA16607 (Ref. 1) Curated2
Sequence conflicti237S → G in BAD97195 (Ref. 2) Curated1
Sequence conflicti375K → E in CAH18661 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_071265317R → C in GAN2; interaction with DDB1 is decreased. 1 PublicationCorresponds to variant dbSNP:rs587777425EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_027264242 – 273AKFLP…ATQCC → VRQGSIIATERIRHELEKSE LQHGLGADSELL in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_027265274 – 597Missing in isoform 2. 1 PublicationAdd BLAST324

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U06631 mRNA Translation: AAA16607.1 Frameshift.
AK223475 mRNA Translation: BAD97195.1
CR749801 mRNA Translation: CAH18661.1
AL139011 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW52731.1
CH471121 Genomic DNA Translation: EAW52732.1
BC013107 mRNA Translation: AAH13107.1
BC080597 mRNA Translation: AAH80597.1
BC098271 mRNA Translation: AAH98271.1
BC099709 mRNA Translation: AAH99709.1
BC099846 mRNA Translation: AAH99846.1
BC111063 mRNA Translation: AAI11064.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1200.1 [Q5TAQ9-1]

NCBI Reference Sequences

More...
RefSeqi
NP_056541.2, NM_015726.3 [Q5TAQ9-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.632447

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000326837; ENSP00000318227; ENSG00000132716 [Q5TAQ9-1]
ENST00000368073; ENSP00000357052; ENSG00000132716 [Q5TAQ9-1]
ENST00000368074; ENSP00000357053; ENSG00000132716 [Q5TAQ9-1]
ENST00000475733; ENSP00000476351; ENSG00000132716 [Q5TAQ9-2]
ENST00000610139; ENSP00000477464; ENSG00000132716 [Q5TAQ9-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
50717

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:50717

UCSC genome browser

More...
UCSCi
uc001fvn.3 human [Q5TAQ9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U06631 mRNA Translation: AAA16607.1 Frameshift.
AK223475 mRNA Translation: BAD97195.1
CR749801 mRNA Translation: CAH18661.1
AL139011 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW52731.1
CH471121 Genomic DNA Translation: EAW52732.1
BC013107 mRNA Translation: AAH13107.1
BC080597 mRNA Translation: AAH80597.1
BC098271 mRNA Translation: AAH98271.1
BC099709 mRNA Translation: AAH99709.1
BC099846 mRNA Translation: AAH99846.1
BC111063 mRNA Translation: AAI11064.1
CCDSiCCDS1200.1 [Q5TAQ9-1]
RefSeqiNP_056541.2, NM_015726.3 [Q5TAQ9-1]
UniGeneiHs.632447

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3I8EX-ray3.40C/D153-165[»]
ProteinModelPortaliQ5TAQ9
SMRiQ5TAQ9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119121, 73 interactors
DIPiDIP-48762N
IntActiQ5TAQ9, 19 interactors
MINTiQ5TAQ9
STRINGi9606.ENSP00000451235

PTM databases

iPTMnetiQ5TAQ9
PhosphoSitePlusiQ5TAQ9

Polymorphism and mutation databases

BioMutaiDCAF8
DMDMi74756455

Proteomic databases

EPDiQ5TAQ9
jPOSTiQ5TAQ9
MaxQBiQ5TAQ9
PaxDbiQ5TAQ9
PeptideAtlasiQ5TAQ9
PRIDEiQ5TAQ9
ProteomicsDBi64861
64862 [Q5TAQ9-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000326837; ENSP00000318227; ENSG00000132716 [Q5TAQ9-1]
ENST00000368073; ENSP00000357052; ENSG00000132716 [Q5TAQ9-1]
ENST00000368074; ENSP00000357053; ENSG00000132716 [Q5TAQ9-1]
ENST00000475733; ENSP00000476351; ENSG00000132716 [Q5TAQ9-2]
ENST00000610139; ENSP00000477464; ENSG00000132716 [Q5TAQ9-2]
GeneIDi50717
KEGGihsa:50717
UCSCiuc001fvn.3 human [Q5TAQ9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
50717
DisGeNETi50717
EuPathDBiHostDB:ENSG00000132716.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DCAF8

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0200230
HGNCiHGNC:24891 DCAF8
HPAiHPA027218
HPA027381
MalaCardsiDCAF8
MIMi610100 phenotype
615820 gene
neXtProtiNX_Q5TAQ9
OpenTargetsiENSG00000132716
Orphaneti401964 Autosomal dominant Charcot-Marie-Tooth disease type 2 with giant axons
PharmGKBiPA165751195

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1334 Eukaryota
KOG3133 Eukaryota
ENOG410XQZP LUCA
GeneTreeiENSGT00530000062951
HOVERGENiHBG053807
InParanoidiQ5TAQ9
KOiK11804
OrthoDBi1270484at2759
PhylomeDBiQ5TAQ9
TreeFamiTF326071

Enzyme and pathway databases

UniPathwayi
UPA00143

ReactomeiR-HSA-8951664 Neddylation
SignaLinkiQ5TAQ9

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DCAF8 human
EvolutionaryTraceiQ5TAQ9

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
50717

Protein Ontology

More...
PROi
PR:Q5TAQ9

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000132716 Expressed in 232 organ(s), highest expression level in left lobe of thyroid gland
ExpressionAtlasiQ5TAQ9 baseline and differential
GenevisibleiQ5TAQ9 HS

Family and domain databases

Gene3Di2.130.10.10, 1 hit
InterProiView protein in InterPro
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PfamiView protein in Pfam
PF00400 WD40, 3 hits
SMARTiView protein in SMART
SM00320 WD40, 7 hits
SUPFAMiSSF50978 SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS50082 WD_REPEATS_2, 1 hit
PS50294 WD_REPEATS_REGION, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDCAF8_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5TAQ9
Secondary accession number(s): D3DVE6
, Q12839, Q4QQI6, Q53F14, Q66K50, Q68CS7, Q96E00
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: December 21, 2004
Last modified: February 13, 2019
This is version 141 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  7. PATHWAY comments
    Index of metabolic and biosynthesis pathways
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again