Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 144 (16 Oct 2019)
Sequence version 1 (21 Dec 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

ATPase family AAA domain-containing protein 3B

Gene

ATAD3B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role in a mitochondrial network organization typical for stem cells, characterized by reduced mitochondrial metabolism, low mtDNA copies and fragmentated mitochondrial network. may act by suppressing ATAD3A function, interfering with ATAD3A interaction with matrix nucleoid complexes.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi352 – 359ATPSequence analysis8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-6798695 Neutrophil degranulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
ATPase family AAA domain-containing protein 3B
Alternative name(s):
AAA-TOB3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ATAD3B
Synonyms:KIAA1273, TOB3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24007 ATAD3B

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
612317 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5T9A4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini2 – 246Mitochondrial intermembraneSequence analysisAdd BLAST245
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a region that is buried within a membrane, but does not cross it.<p><a href='/help/intramem' target='_top'>More...</a></p>Intramembranei247 – 264HelicalSequence analysisAdd BLAST18
Topological domaini265 – 648Mitochondrial intermembraneSequence analysisAdd BLAST384

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
83858

Open Targets

More...
OpenTargetsi
ENSG00000160072

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134993325

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q5T9A4

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ATAD3B

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74745646

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000848002 – 648ATPase family AAA domain-containing protein 3BAdd BLAST647

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineCombined sources1
Modified residuei427N6-acetyllysineCombined sources1
Modified residuei495N6-acetyllysineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q5T9A4

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5T9A4

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q5T9A4

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q5T9A4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5T9A4

PeptideAtlas

More...
PeptideAtlasi
Q5T9A4

PRoteomics IDEntifications database

More...
PRIDEi
Q5T9A4

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
64783 [Q5T9A4-1]
64784 [Q5T9A4-2]
64785 [Q5T9A4-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5T9A4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5T9A4

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q5T9A4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Tends to be down-regulated in differentiated cells and re-expressed in pluripotent stem cells or cancer cells (at protein level).2 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in proliferating embryonic stem cells and down-regulated during differentiation.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated by MYC.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000160072 Expressed in 189 organ(s), highest expression level in islet of Langerhans

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5T9A4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA058968
HPA064867
HPA065305

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms heterooligomers with ATAD3A.

Interacts with components of the mitochondrial ribosome, including MRPL11 and MRPS18B, and with other proteins involved in mitochondrial RNA metabolism, possibly via interaction with ATAD3A.

Interacts with GADD45GIP1.

2 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123774, 71 interactors

Protein interaction database and analysis system

More...
IntActi
Q5T9A4, 50 interactors

Molecular INTeraction database

More...
MINTi
Q5T9A4

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000311766

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q5T9A4

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili69 – 214Sequence analysisAdd BLAST146

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi18 – 24Poly-Pro7

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the AAA ATPase family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IT4H Eukaryota
COG0465 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000167742

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231291

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5T9A4

KEGG Orthology (KO)

More...
KOi
K17681

Identification of Orthologs from Complete Genome Data

More...
OMAi
HFDNCVL

Database of Orthologous Groups

More...
OrthoDBi
357201at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5T9A4

TreeFam database of animal gene trees

More...
TreeFami
TF313922

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003593 AAA+_ATPase
IPR039188 ATAD3
IPR003959 ATPase_AAA_core
IPR021911 DUF3523
IPR027417 P-loop_NTPase

The PANTHER Classification System

More...
PANTHERi
PTHR23075 PTHR23075, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00004 AAA, 1 hit
PF12037 DUF3523, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00382 AAA, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540 SSF52540, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q5T9A4-1) [UniParc]FASTAAdd to basket
Also known as: AAA-TOB3l

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSWLFGVNKG PKGEGAGPPP PLPPAQPGAE GGGDRGLGDR PAPKDKWSNF
60 70 80 90 100
DPTGLERAAK AARELEHSRY AKEALNLAQM QEQTLQLEQQ SKLKEYEAAV
110 120 130 140 150
EQLKSEQIRA QAEERRKTLS EETRQHQARA QYQDKLARQR YEDQLKQQQL
160 170 180 190 200
LNEENLRKQE ESVQKQEAMR RATVEREMEL RHKNEMLRVE TEARARAKAE
210 220 230 240 250
RENADIIREQ IRLKASEHRQ TVLESIRTAG TLFGEGFRAF VTDRDKVTAT
260 270 280 290 300
VAGLTLLAVG VYSAKNATAV TGRFIEARLG KPSLVRETSR ITVLEALRHP
310 320 330 340 350
IQVSRRLLSR PQDVLEGVVL SPSLEARVRD IAIATRNTKK NRGLYRHILL
360 370 380 390 400
YGPPGTGKTL FAKKLALHSG MDYAIMTGGD VAPMGREGVT AMHKLFDWAN
410 420 430 440 450
TSRRGLLLFM DEADAFLRKR ATEEISKDLR ATLNAFLYHM GQHSNKFMLV
460 470 480 490 500
LASNLPEQFD CAINSRIDVM VHFDLPQQEE RERLVRLHFD NCVLKPATEG
510 520 530 540 550
KRRLKLAQFD YGRKCSEVAR LTEGMSGREI AQLAVSWQAT AYASKDGVLT
560 570 580 590 600
EAMMDACVQD AVQQYRQKMR WLKAEGPGRG VEHPLSGVQG ETLTSWSLAT
610 620 630 640
DPSYPCLAGP CTFRICSWMG TGLCPGPLSP RMSCGGGRPF CPPGHPLL
Length:648
Mass (Da):72,573
Last modified:December 21, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5133DB55E3415707
GO
Isoform 2 (identifier: Q5T9A4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-118: Missing.
     119-128: LSEETRQHQA → MCLCRPLLPQ
     252-284: AGLTLLAVGVYSAKNATAVTGRFIEARLGKPSL → NIFIKQGWQVAERQHVGASWSPRSCPCRLCTAL
     285-648: Missing.

Note: No experimental confirmation available.
Show »
Length:166
Mass (Da):19,508
Checksum:i15325B2EF9B86B13
GO
Isoform 3 (identifier: Q5T9A4-3) [UniParc]FASTAAdd to basket
Also known as: AAA-TOB3s

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: Missing.
     47-94: WSNFDPTGLE...LQLEQQSKLK → MQLEALNLLH...VPAGECCALQ

Show »
Length:602
Mass (Da):67,608
Checksum:iC787D0F1D620B06F
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA86587 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti149Q → R in AAH02542 (PubMed:15489334).Curated1
Sequence conflicti149Q → R in AAH18701 (PubMed:15489334).Curated1
Sequence conflicti153E → V in AK128357 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0481207V → I. Corresponds to variant dbSNP:rs1240504Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0156371 – 118Missing in isoform 2. 1 PublicationAdd BLAST118
Alternative sequenceiVSP_0156381 – 46Missing in isoform 3. 2 PublicationsAdd BLAST46
Alternative sequenceiVSP_01563947 – 94WSNFD…QSKLK → MQLEALNLLHTLVWARSLCR AGAVQTQERLSGSASPEQVP AGECCALQ in isoform 3. 2 PublicationsAdd BLAST48
Alternative sequenceiVSP_015640119 – 128LSEETRQHQA → MCLCRPLLPQ in isoform 2. 1 Publication10
Alternative sequenceiVSP_015641252 – 284AGLTL…GKPSL → NIFIKQGWQVAERQHVGASW SPRSCPCRLCTAL in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_015642285 – 648Missing in isoform 2. 1 PublicationAdd BLAST364

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB033099 mRNA Translation: BAA86587.1 Different initiation.
AK128357 mRNA No translation available.
AK290586 mRNA Translation: BAF83275.1
AL157945 Genomic DNA No translation available.
CH471183 Genomic DNA Translation: EAW56193.1
BC002542 mRNA Translation: AAH02542.1
BC009938 mRNA No translation available.
BC018701 mRNA Translation: AAH18701.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS30.1 [Q5T9A4-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001304167.1, NM_001317238.1 [Q5T9A4-3]
NP_114127.3, NM_031921.5 [Q5T9A4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000308647; ENSP00000311766; ENSG00000160072 [Q5T9A4-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
83858

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:83858

UCSC genome browser

More...
UCSCi
uc001afv.4 human [Q5T9A4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB033099 mRNA Translation: BAA86587.1 Different initiation.
AK128357 mRNA No translation available.
AK290586 mRNA Translation: BAF83275.1
AL157945 Genomic DNA No translation available.
CH471183 Genomic DNA Translation: EAW56193.1
BC002542 mRNA Translation: AAH02542.1
BC009938 mRNA No translation available.
BC018701 mRNA Translation: AAH18701.1
CCDSiCCDS30.1 [Q5T9A4-1]
RefSeqiNP_001304167.1, NM_001317238.1 [Q5T9A4-3]
NP_114127.3, NM_031921.5 [Q5T9A4-1]

3D structure databases

SMRiQ5T9A4
ModBaseiSearch...

Protein-protein interaction databases

BioGridi123774, 71 interactors
IntActiQ5T9A4, 50 interactors
MINTiQ5T9A4
STRINGi9606.ENSP00000311766

PTM databases

iPTMnetiQ5T9A4
PhosphoSitePlusiQ5T9A4
SwissPalmiQ5T9A4

Polymorphism and mutation databases

BioMutaiATAD3B
DMDMi74745646

Proteomic databases

EPDiQ5T9A4
jPOSTiQ5T9A4
MassIVEiQ5T9A4
MaxQBiQ5T9A4
PaxDbiQ5T9A4
PeptideAtlasiQ5T9A4
PRIDEiQ5T9A4
ProteomicsDBi64783 [Q5T9A4-1]
64784 [Q5T9A4-2]
64785 [Q5T9A4-3]

Genome annotation databases

EnsembliENST00000308647; ENSP00000311766; ENSG00000160072 [Q5T9A4-1]
GeneIDi83858
KEGGihsa:83858
UCSCiuc001afv.4 human [Q5T9A4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
83858
DisGeNETi83858

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ATAD3B
HGNCiHGNC:24007 ATAD3B
HPAiHPA058968
HPA064867
HPA065305
MIMi612317 gene
neXtProtiNX_Q5T9A4
OpenTargetsiENSG00000160072
PharmGKBiPA134993325

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IT4H Eukaryota
COG0465 LUCA
GeneTreeiENSGT00940000167742
HOGENOMiHOG000231291
InParanoidiQ5T9A4
KOiK17681
OMAiHFDNCVL
OrthoDBi357201at2759
PhylomeDBiQ5T9A4
TreeFamiTF313922

Enzyme and pathway databases

ReactomeiR-HSA-6798695 Neutrophil degranulation

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ATAD3B human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
83858
PharosiQ5T9A4

Protein Ontology

More...
PROi
PR:Q5T9A4

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000160072 Expressed in 189 organ(s), highest expression level in islet of Langerhans
GenevisibleiQ5T9A4 HS

Family and domain databases

InterProiView protein in InterPro
IPR003593 AAA+_ATPase
IPR039188 ATAD3
IPR003959 ATPase_AAA_core
IPR021911 DUF3523
IPR027417 P-loop_NTPase
PANTHERiPTHR23075 PTHR23075, 2 hits
PfamiView protein in Pfam
PF00004 AAA, 1 hit
PF12037 DUF3523, 1 hit
SMARTiView protein in SMART
SM00382 AAA, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiATD3B_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5T9A4
Secondary accession number(s): A8K3H1
, Q6ZRB5, Q9BUK4, Q9ULE7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 13, 2005
Last sequence update: December 21, 2004
Last modified: October 16, 2019
This is version 144 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again