Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 135 (08 May 2019)
Sequence version 1 (21 Dec 2004)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Zinc finger protein 618

Gene

ZNF618

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri147 – 169C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri188 – 210C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri256 – 278C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri392 – 414C2H2-type 4PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger protein 618
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZNF618
Synonyms:KIAA1952
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29416 ZNF618

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5T7W0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
114991

Open Targets

More...
OpenTargetsi
ENSG00000157657

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31532

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZNF618

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74762243

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002868111 – 954Zinc finger protein 618Add BLAST954

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki63Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki81Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki239Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki437Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Acetylation, Isopeptide bond, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q5T7W0

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5T7W0

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q5T7W0

PeptideAtlas

More...
PeptideAtlasi
Q5T7W0

PRoteomics IDEntifications database

More...
PRIDEi
Q5T7W0

ProteomicsDB human proteome resource

More...
ProteomicsDBi
64691
64692 [Q5T7W0-2]
64693 [Q5T7W0-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5T7W0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5T7W0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000157657 Expressed in 186 organ(s), highest expression level in secondary oocyte

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5T7W0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5T7W0 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA023116
HPA061732

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
125407, 15 interactors

Protein interaction database and analysis system

More...
IntActi
Q5T7W0, 10 interactors

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri147 – 169C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri188 – 210C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri256 – 278C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri392 – 414C2H2-type 4PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153306

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5T7W0

Identification of Orthologs from Complete Genome Data

More...
OMAi
IHHWVQN

Database of Orthologous Groups

More...
OrthoDBi
118368at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5T7W0

TreeFam database of animal gene trees

More...
TreeFami
TF331270

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR037220 BED_dom
IPR012337 RNaseH-like_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00355 ZnF_C2H2, 4 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF140996 SSF140996, 1 hit
SSF53098 SSF53098, 1 hit
SSF57667 SSF57667, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 4 hits
PS50157 ZINC_FINGER_C2H2_2, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5T7W0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNQPGGAAAP QADGASAAGR KSTASRERLK RSQKSTKVEG PEPVPAEASL
60 70 80 90 100
SAEQGTMTEV KVKTELPDDY IQEVIWQGEA KEEKKAVSKD GTSDVPAEIC
110 120 130 140 150
VVIGGVRNQQ TLDGKAPEGS PHGGSVRSRY SGTWIFDQAL RYASGSYECG
160 170 180 190 200
ICGKKYKYYN CFQTHVRAHR DTEATSGEGA SQSNNFRYTC DICGKKYKYY
210 220 230 240 250
SCFQEHRDLH AVDVFSVEGA PENRADPFDQ GVVATDEVKE EPPEPFQKIG
260 270 280 290 300
PKTGNYTCEF CGKQYKYYTP YQEHVALHAP ISTAPGWEPP DDPDTGSECS
310 320 330 340 350
HPEVSPSPRF VAAKTQTNQS GKKAPASVVR CATLLHRTPP ATQTQTFRTP
360 370 380 390 400
NSGSPASKAT AAESAFSRRV EGKAQNHFEE TNSSSQNSSE PYTCGACGIQ
410 420 430 440 450
FQFYNNLLEH MQSHAADNEN NIASNQSRSP PAVVEEKWKP QAQRNSANNT
460 470 480 490 500
TTSGLTPNSM IPEKERQNIA ERLLRVMCAD LGALSVVSGK EFLKLAQTLV
510 520 530 540 550
DSGARYGAFS VTEILGNFNT LALKHLPRMY NQVKVKVTCA LGSNACLGIG
560 570 580 590 600
VTCHSQSVGP DSCYILTAYQ AEGNHIKSYV LGVKGADIRD SGDLVHHWVQ
610 620 630 640 650
NVLSEFVMSE IRTVYVTDCR VSTSAFSKAG MCLRCSACAL NSVVQSVLSK
660 670 680 690 700
RTLQARSMHE VIELLNVCED LAGSTGLAKE TFGSLEETSP PPCWNSVTDS
710 720 730 740 750
LLLVHERYEQ ICEFYSRAKK MNLIQSLNKH LLSNLAAILT PVKQAVIELS
760 770 780 790 800
NESQPTLQLV LPTYVRLEKL FTAKANDAGT VSKLCHLFLE ALKENFKVHP
810 820 830 840 850
AHKVAMILDP QQKLRPVPPY QHEEIIGKVC ELINEVKESW AEEADFEPAA
860 870 880 890 900
KKPRSAAVEN PAAQEDDRLG KNEVYDYLQE PLFQATPDLF QYWSCVTQKH
910 920 930 940 950
TKLAKLAFWL LAVPAVGARS GCVNMCEQAL LIKRRRLLSP EDMNKLMFLK

SNML
Length:954
Mass (Da):104,956
Last modified:December 21, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA50304AA0D61B92E
GO
Isoform 2 (identifier: Q5T7W0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     113-144: Missing.
     252-252: K → MNNITSDIFKKKEVRQCQKRE
     282-363: STAPGWEPPD...SPASKATAAE → K

Note: No experimental confirmation available.
Show »
Length:861
Mass (Da):95,616
Checksum:i825DDF6381A98C7C
GO
Isoform 3 (identifier: Q5T7W0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     113-144: Missing.
     283-313: TAPGWEPPDDPDTGSECSHPEVSPSPRFVAA → EYLLPVGMGVGGPGTGWASRWPGLWNLARKW
     314-954: Missing.

Note: No experimental confirmation available.
Show »
Length:281
Mass (Da):30,950
Checksum:iB5AADB5EF7126CC6
GO
Isoform 4 (identifier: Q5T7W0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     113-144: Missing.
     361-361: Missing.

Note: No experimental confirmation available.
Show »
Length:921
Mass (Da):101,449
Checksum:i9A20C9D1122FD746
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B5MDS3B5MDS3_HUMAN
Zinc finger protein 618
ZNF618
375Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1ALC2B1ALC2_HUMAN
Zinc finger protein 618
ZNF618
303Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH36039 differs from that shown. Reason: Erroneous termination at position 241. Translated as Glu.Curated
The sequence AAH53892 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB85538 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti211A → T in AAI36288 (PubMed:15489334).Curated1
Sequence conflicti662I → V in AAH36039 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_025179113 – 144Missing in isoform 2, isoform 3 and isoform 4. 2 PublicationsAdd BLAST32
Alternative sequenceiVSP_025180252K → MNNITSDIFKKKEVRQCQKR E in isoform 2. 1 Publication1
Alternative sequenceiVSP_025181282 – 363STAPG…ATAAE → K in isoform 2. 1 PublicationAdd BLAST82
Alternative sequenceiVSP_025182283 – 313TAPGW…RFVAA → EYLLPVGMGVGGPGTGWASR WPGLWNLARKW in isoform 3. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_025183314 – 954Missing in isoform 3. 1 PublicationAdd BLAST641
Alternative sequenceiVSP_055968361Missing in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB075832 mRNA Translation: BAB85538.1 Different initiation.
AK126896 mRNA No translation available.
AL137850 Genomic DNA No translation available.
AL162393 Genomic DNA No translation available.
BC036039 mRNA Translation: AAH36039.1 Sequence problems.
BC053892 mRNA Translation: AAH53892.1 Different initiation.
BC012922 mRNA Translation: AAH12922.1
BC136287 mRNA Translation: AAI36288.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS48008.1 [Q5T7W0-2]
CCDS83402.1 [Q5T7W0-1]
CCDS83403.1 [Q5T7W0-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001304969.1, NM_001318040.1 [Q5T7W0-4]
NP_001304970.1, NM_001318041.1
NP_001304971.1, NM_001318042.1 [Q5T7W0-1]
NP_588615.2, NM_133374.2 [Q5T7W0-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000288466; ENSP00000288466; ENSG00000157657 [Q5T7W0-2]
ENST00000374126; ENSP00000363241; ENSG00000157657 [Q5T7W0-1]
ENST00000615615; ENSP00000483198; ENSG00000157657 [Q5T7W0-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
114991

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:114991

UCSC genome browser

More...
UCSCi
uc004bic.4 human [Q5T7W0-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB075832 mRNA Translation: BAB85538.1 Different initiation.
AK126896 mRNA No translation available.
AL137850 Genomic DNA No translation available.
AL162393 Genomic DNA No translation available.
BC036039 mRNA Translation: AAH36039.1 Sequence problems.
BC053892 mRNA Translation: AAH53892.1 Different initiation.
BC012922 mRNA Translation: AAH12922.1
BC136287 mRNA Translation: AAI36288.1
CCDSiCCDS48008.1 [Q5T7W0-2]
CCDS83402.1 [Q5T7W0-1]
CCDS83403.1 [Q5T7W0-4]
RefSeqiNP_001304969.1, NM_001318040.1 [Q5T7W0-4]
NP_001304970.1, NM_001318041.1
NP_001304971.1, NM_001318042.1 [Q5T7W0-1]
NP_588615.2, NM_133374.2 [Q5T7W0-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi125407, 15 interactors
IntActiQ5T7W0, 10 interactors

PTM databases

iPTMnetiQ5T7W0
PhosphoSitePlusiQ5T7W0

Polymorphism and mutation databases

BioMutaiZNF618
DMDMi74762243

Proteomic databases

EPDiQ5T7W0
jPOSTiQ5T7W0
MaxQBiQ5T7W0
PeptideAtlasiQ5T7W0
PRIDEiQ5T7W0
ProteomicsDBi64691
64692 [Q5T7W0-2]
64693 [Q5T7W0-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000288466; ENSP00000288466; ENSG00000157657 [Q5T7W0-2]
ENST00000374126; ENSP00000363241; ENSG00000157657 [Q5T7W0-1]
ENST00000615615; ENSP00000483198; ENSG00000157657 [Q5T7W0-4]
GeneIDi114991
KEGGihsa:114991
UCSCiuc004bic.4 human [Q5T7W0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
114991
DisGeNETi114991

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZNF618
HGNCiHGNC:29416 ZNF618
HPAiHPA023116
HPA061732
neXtProtiNX_Q5T7W0
OpenTargetsiENSG00000157657
PharmGKBiPA31532

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00940000153306
InParanoidiQ5T7W0
OMAiIHHWVQN
OrthoDBi118368at2759
PhylomeDBiQ5T7W0
TreeFamiTF331270

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ZNF618 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
114991

Protein Ontology

More...
PROi
PR:Q5T7W0

Gene expression databases

BgeeiENSG00000157657 Expressed in 186 organ(s), highest expression level in secondary oocyte
ExpressionAtlasiQ5T7W0 baseline and differential
GenevisibleiQ5T7W0 HS

Family and domain databases

InterProiView protein in InterPro
IPR037220 BED_dom
IPR012337 RNaseH-like_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 4 hits
SUPFAMiSSF140996 SSF140996, 1 hit
SSF53098 SSF53098, 1 hit
SSF57667 SSF57667, 2 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 4 hits
PS50157 ZINC_FINGER_C2H2_2, 4 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZN618_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5T7W0
Secondary accession number(s): B9EG82
, Q4G0X6, Q5T7W1, Q6ZT53, Q7Z6B9, Q8TF49, Q96E49
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: December 21, 2004
Last modified: May 8, 2019
This is version 135 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again