Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Artemin

Gene

ARTN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Ligand for the GFR-alpha-3-RET receptor complex but can also activate the GFR-alpha-1-RET receptor complex. Supports the survival of sensory and sympathetic peripheral neurons in culture and also supports the survival of dopaminergic neurons of the ventral mid-brain. Strong attractant of gut hematopoietic cells thus promoting the formation Peyer's patch-like structures, a major component of the gut-associated lymphoid tissue.2 Publications

GO - Molecular functioni

  • growth factor activity Source: UniProtKB-KW
  • Ras guanyl-nucleotide exchange factor activity Source: Reactome
  • signaling receptor binding Source: ProtInc

GO - Biological processi

Keywordsi

Molecular functionGrowth factor

Enzyme and pathway databases

ReactomeiR-HSA-419037 NCAM1 interactions
R-HSA-5673001 RAF/MAP kinase cascade
R-HSA-8853659 RET signaling
SIGNORiQ5T4W7

Names & Taxonomyi

Protein namesi
Recommended name:
Artemin
Alternative name(s):
Enovin
Neublastin
Gene namesi
Name:ARTN
Synonyms:EVN
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000117407.16
HGNCiHGNC:727 ARTN
MIMi603886 gene
neXtProtiNX_Q5T4W7

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi9048
OpenTargetsiENSG00000117407
PharmGKBiPA25017

Polymorphism and mutation databases

BioMutaiARTN
DMDMi74744994

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 39Sequence analysisAdd BLAST39
PropeptideiPRO_000024028640 – 107Sequence analysisAdd BLAST68
ChainiPRO_0000240287108 – 220ArteminAdd BLAST113

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi123 ↔ 1881 Publication
Disulfide bondi150 ↔ 2161 Publication
Disulfide bondi154 ↔ 2181 Publication
Disulfide bondi187Interchain1 Publication
Glycosylationi202N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ5T4W7
PRIDEiQ5T4W7
ProteomicsDBi64491
64492 [Q5T4W7-2]
64493 [Q5T4W7-3]
TopDownProteomicsiQ5T4W7-3 [Q5T4W7-3]

PTM databases

iPTMnetiQ5T4W7
PhosphoSitePlusiQ5T4W7

Expressioni

Tissue specificityi

Ubiquitous. Expressed at high levels in peripheral tissues including prostate, placenta, pancreas, heart, kidney, pituitary gland, lung and testis. Expressed at low levels in the brain.2 Publications

Developmental stagei

Expressed during embryogenesis. High level expression seen in fetal kidney and lung while a low level expression seen in the fetal brain.1 Publication

Gene expression databases

BgeeiENSG00000117407 Expressed in 147 organ(s), highest expression level in uterus
CleanExiHS_ARTN
ExpressionAtlasiQ5T4W7 baseline and differential
GenevisibleiQ5T4W7 HS

Interactioni

Subunit structurei

Homodimer; disulfide-linked. Binds to RET (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
GFRA3O606094EBI-15586241,EBI-15586309

GO - Molecular functioni

Protein-protein interaction databases

BioGridi114510, 1 interactor
DIPiDIP-29113N
IntActiQ5T4W7, 1 interactor
STRINGi9606.ENSP00000387435

Structurei

Secondary structure

1220
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ5T4W7
SMRiQ5T4W7
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ5T4W7

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi45 – 100Pro-richAdd BLAST56

Sequence similaritiesi

Belongs to the TGF-beta family. GDNF subfamily.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410J0YD Eukaryota
ENOG4111W7C LUCA
GeneTreeiENSGT00520000055559
HOGENOMiHOG000220877
HOVERGENiHBG080137
InParanoidiQ5T4W7
OMAiISQPCCR
OrthoDBiEOG091G0L16
PhylomeDBiQ5T4W7
TreeFamiTF332366

Family and domain databases

Gene3Di2.10.90.10, 1 hit
InterProiView protein in InterPro
IPR029034 Cystine-knot_cytokine
IPR001839 TGF-b_C
PfamiView protein in Pfam
PF00019 TGF_beta, 1 hit
SMARTiView protein in SMART
SM00204 TGFB, 1 hit
SUPFAMiSSF57501 SSF57501, 1 hit
PROSITEiView protein in PROSITE
PS51362 TGF_BETA_2, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5T4W7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MELGLGGLST LSHCPWPRQQ PALWPTLAAL ALLSSVAEAS LGSAPRSPAP
60 70 80 90 100
REGPPPVLAS PAGHLPGGRT ARWCSGRARR PPPQPSRPAP PPPAPPSALP
110 120 130 140 150
RGGRAARAGG PGSRARAAGA RGCRLRSQLV PVRALGLGHR SDELVRFRFC
160 170 180 190 200
SGSCRRARSP HDLSLASLLG AGALRPPPGS RPVSQPCCRP TRYEAVSFMD
210 220
VNSTWRTVDR LSATACGCLG
Length:220
Mass (Da):22,878
Last modified:December 21, 2004 - v1
Checksum:iC61B65EF3A51FEE4
GO
Isoform 2 (identifier: Q5T4W7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-19: MELGLGGLSTLSHCPWPRQ → MPGLISARGQPLLEVLPPQAHLGALFLPEAPLGLSA

Show »
Length:237
Mass (Da):24,471
Checksum:i11C64C4B510CE3AB
GO
Isoform 3 (identifier: Q5T4W7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     21-21: P → APLGLSAQP

Show »
Length:228
Mass (Da):23,616
Checksum:i568BFD09EE05D0FC
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PIK2E9PIK2_HUMAN
Artemin
ARTN
66Annotation score:
E9PN22E9PN22_HUMAN
Artemin
ARTN
89Annotation score:
E9PLG3E9PLG3_HUMAN
Artemin
ARTN
76Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02671819Q → R3 PublicationsCorresponds to variant dbSNP:rs2242637Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0193351 – 19MELGL…PWPRQ → MPGLISARGQPLLEVLPPQA HLGALFLPEAPLGLSA in isoform 2. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_01933621P → APLGLSAQP in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF109401 mRNA Translation: AAC98690.1
AF115765 Genomic DNA Translation: AAD13109.1
AF115765 Genomic DNA Translation: AAD13110.1
AJ245628 Genomic DNA Translation: CAB52396.1
AF120274 mRNA Translation: AAD21075.1
AL357079 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07074.1
CH471059 Genomic DNA Translation: EAX07077.1
CH471059 Genomic DNA Translation: EAX07079.1
CH471059 Genomic DNA Translation: EAX07078.1
CH471059 Genomic DNA Translation: EAX07080.1
BC062375 mRNA Translation: AAH62375.1
CCDSiCCDS501.1 [Q5T4W7-1]
CCDS502.1 [Q5T4W7-3]
RefSeqiNP_001129687.1, NM_001136215.1 [Q5T4W7-3]
NP_476431.2, NM_057090.2 [Q5T4W7-3]
NP_476432.2, NM_057091.2 [Q5T4W7-1]
UniGeneiHs.632404

Genome annotation databases

EnsembliENST00000372354; ENSP00000361429; ENSG00000117407 [Q5T4W7-1]
ENST00000372359; ENSP00000361434; ENSG00000117407 [Q5T4W7-1]
ENST00000414809; ENSP00000387435; ENSG00000117407 [Q5T4W7-3]
ENST00000438616; ENSP00000391998; ENSG00000117407 [Q5T4W7-2]
ENST00000498139; ENSP00000436727; ENSG00000117407 [Q5T4W7-3]
GeneIDi9048
KEGGihsa:9048
UCSCiuc001cks.4 human [Q5T4W7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF109401 mRNA Translation: AAC98690.1
AF115765 Genomic DNA Translation: AAD13109.1
AF115765 Genomic DNA Translation: AAD13110.1
AJ245628 Genomic DNA Translation: CAB52396.1
AF120274 mRNA Translation: AAD21075.1
AL357079 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07074.1
CH471059 Genomic DNA Translation: EAX07077.1
CH471059 Genomic DNA Translation: EAX07079.1
CH471059 Genomic DNA Translation: EAX07078.1
CH471059 Genomic DNA Translation: EAX07080.1
BC062375 mRNA Translation: AAH62375.1
CCDSiCCDS501.1 [Q5T4W7-1]
CCDS502.1 [Q5T4W7-3]
RefSeqiNP_001129687.1, NM_001136215.1 [Q5T4W7-3]
NP_476431.2, NM_057090.2 [Q5T4W7-3]
NP_476432.2, NM_057091.2 [Q5T4W7-1]
UniGeneiHs.632404

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2ASKX-ray1.55A/B108-220[»]
2GH0X-ray1.92C/D122-220[»]
2GYRX-ray2.60A/B/C/D/E/F122-220[»]
2GYZX-ray1.76A122-220[»]
ProteinModelPortaliQ5T4W7
SMRiQ5T4W7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114510, 1 interactor
DIPiDIP-29113N
IntActiQ5T4W7, 1 interactor
STRINGi9606.ENSP00000387435

PTM databases

iPTMnetiQ5T4W7
PhosphoSitePlusiQ5T4W7

Polymorphism and mutation databases

BioMutaiARTN
DMDMi74744994

Proteomic databases

PaxDbiQ5T4W7
PRIDEiQ5T4W7
ProteomicsDBi64491
64492 [Q5T4W7-2]
64493 [Q5T4W7-3]
TopDownProteomicsiQ5T4W7-3 [Q5T4W7-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372354; ENSP00000361429; ENSG00000117407 [Q5T4W7-1]
ENST00000372359; ENSP00000361434; ENSG00000117407 [Q5T4W7-1]
ENST00000414809; ENSP00000387435; ENSG00000117407 [Q5T4W7-3]
ENST00000438616; ENSP00000391998; ENSG00000117407 [Q5T4W7-2]
ENST00000498139; ENSP00000436727; ENSG00000117407 [Q5T4W7-3]
GeneIDi9048
KEGGihsa:9048
UCSCiuc001cks.4 human [Q5T4W7-1]

Organism-specific databases

CTDi9048
DisGeNETi9048
EuPathDBiHostDB:ENSG00000117407.16
GeneCardsiARTN
HGNCiHGNC:727 ARTN
MIMi603886 gene
neXtProtiNX_Q5T4W7
OpenTargetsiENSG00000117407
PharmGKBiPA25017
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J0YD Eukaryota
ENOG4111W7C LUCA
GeneTreeiENSGT00520000055559
HOGENOMiHOG000220877
HOVERGENiHBG080137
InParanoidiQ5T4W7
OMAiISQPCCR
OrthoDBiEOG091G0L16
PhylomeDBiQ5T4W7
TreeFamiTF332366

Enzyme and pathway databases

ReactomeiR-HSA-419037 NCAM1 interactions
R-HSA-5673001 RAF/MAP kinase cascade
R-HSA-8853659 RET signaling
SIGNORiQ5T4W7

Miscellaneous databases

EvolutionaryTraceiQ5T4W7
GeneWikiiArtemin
GenomeRNAii9048
PROiPR:Q5T4W7
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000117407 Expressed in 147 organ(s), highest expression level in uterus
CleanExiHS_ARTN
ExpressionAtlasiQ5T4W7 baseline and differential
GenevisibleiQ5T4W7 HS

Family and domain databases

Gene3Di2.10.90.10, 1 hit
InterProiView protein in InterPro
IPR029034 Cystine-knot_cytokine
IPR001839 TGF-b_C
PfamiView protein in Pfam
PF00019 TGF_beta, 1 hit
SMARTiView protein in SMART
SM00204 TGFB, 1 hit
SUPFAMiSSF57501 SSF57501, 1 hit
PROSITEiView protein in PROSITE
PS51362 TGF_BETA_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiARTN_HUMAN
AccessioniPrimary (citable) accession number: Q5T4W7
Secondary accession number(s): D3DPY1
, D3DPY3, O95441, O96030, Q6P6A3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: December 21, 2004
Last modified: September 12, 2018
This is version 115 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again