Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 116 (07 Oct 2020)
Sequence version 1 (21 Dec 2004)
Previous versions | rss
Add a publicationFeedback
Protein

Testis-expressed protein 35

Gene

TEX35

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q5T0J7

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Testis-expressed protein 35
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TEX35
Synonyms:C1orf49
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000240021.9

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25366, TEX35

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5T0J7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
84066

Open Targets

More...
OpenTargetsi
ENSG00000240021

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134904440

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q5T0J7, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TEX35

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74744310

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002511871 – 233Testis-expressed protein 35Add BLAST233

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5T0J7

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q5T0J7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5T0J7

PeptideAtlas

More...
PeptideAtlasi
Q5T0J7

PRoteomics IDEntifications database

More...
PRIDEi
Q5T0J7

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
64172 [Q5T0J7-1]
64173 [Q5T0J7-2]
64174 [Q5T0J7-3]
64175 [Q5T0J7-4]
64176

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5T0J7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5T0J7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Testis-specific.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000240021, Expressed in testis and 96 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5T0J7, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5T0J7, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000240021, Tissue enriched (testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
123861, 33 interactors

Protein interaction database and analysis system

More...
IntActi
Q5T0J7, 31 interactors

Molecular INTeraction database

More...
MINTi
Q5T0J7

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000323795

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q5T0J7, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili45 – 111Sequence analysisAdd BLAST67

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502RVNR, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000011962

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_086070_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5T0J7

Identification of Orthologs from Complete Genome Data

More...
OMAi
KCILCAL

Database of Orthologous Groups

More...
OrthoDBi
1400673at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5T0J7

TreeFam database of animal gene trees

More...
TreeFami
TF337831

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027874, Tex35

The PANTHER Classification System

More...
PANTHERi
PTHR36860, PTHR36860, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15079, Tsc35, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5T0J7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSAKRAELKK THLSKNYKAV CLELKPEPTK TFDYKAVKQE GRFTKAGVTQ
60 70 80 90 100
DLKNELREVR EELKEKMEEI KQIKDLMDKD FDKLHEFVEI MKEMQKDMDE
110 120 130 140 150
KMDILINTQK NYKLPLRRAP KEQQELRLMG KTHREPQLRP KKMDGASGVN
160 170 180 190 200
GAPCALHKKT MAPQKTKQGS LDPLHHCGTC CEKCLLCALK NNYNRGNIPS
210 220 230
EASGLYKGGE EPVTTQPSVG HAVPAPKSQT EGR
Length:233
Mass (Da):26,518
Last modified:December 21, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0B8B9168E1809B05
GO
Isoform 2 (identifier: Q5T0J7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     13-13: L → LVKERHCWT
     196-233: GNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGR → GIYAAVGLLDLW

Show »
Length:215
Mass (Da):25,014
Checksum:iB34BB92695CB7868
GO
Isoform 3 (identifier: Q5T0J7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     182-233: EKCLLCALKNNYNRGNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGR → VSETLPEPSTGARPLAPAPW

Show »
Length:201
Mass (Da):23,096
Checksum:iB6B7161A1248EF65
GO
Isoform 4 (identifier: Q5T0J7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-76: Missing.
     196-233: GNIPSEASGL...PAPKSQTEGR → AAPLKEARHL...MRDEINSERR

Show »
Length:179
Mass (Da):20,199
Checksum:i28CAC48DF030515F
GO
Isoform 5 (identifier: Q5T0J7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     196-233: GNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGR → AQLQNLPAVPIHHLQAP

Show »
Length:212
Mass (Da):24,531
Checksum:iA23C8F537A6CD276
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E5RIH0E5RIH0_HUMAN
Testis-expressed protein 35
TEX35
88Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5T0K0Q5T0K0_HUMAN
Testis-expressed protein 35
TEX35
99Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5T0J5Q5T0J5_HUMAN
Testis-expressed protein 35
TEX35
50Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti14S → C in CAB66629 (PubMed:11230166).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02765655E → G. Corresponds to variant dbSNP:rs16852957Ensembl.1
Natural variantiVAR_027657146A → G. Corresponds to variant dbSNP:rs12079481Ensembl.1
Natural variantiVAR_059592171L → P. Corresponds to variant dbSNP:rs3813636Ensembl.1
Natural variantiVAR_027658171L → R1 PublicationCorresponds to variant dbSNP:rs3813636Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0207371 – 76Missing in isoform 4. 1 PublicationAdd BLAST76
Alternative sequenceiVSP_02073813L → LVKERHCWT in isoform 2. 1 Publication1
Alternative sequenceiVSP_020739182 – 233EKCLL…QTEGR → VSETLPEPSTGARPLAPAPW in isoform 3. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_020740196 – 233GNIPS…QTEGR → GIYAAVGLLDLW in isoform 2. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_020741196 – 233GNIPS…QTEGR → AAPLKEARHLLTANSIDPSA ALVLLIEFLLLTLVTGAAAP GLDACGHQRNMRDEINSERR in isoform 4. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_045739196 – 233GNIPS…QTEGR → AQLQNLPAVPIHHLQAP in isoform 5. CuratedAdd BLAST38

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AL136694 mRNA Translation: CAB66629.1
AK093269 mRNA Translation: BAC04115.1
AK097518 mRNA Translation: BAC05085.1
AL513013 Genomic DNA No translation available.
BC034972 mRNA Translation: AAH34972.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1323.1 [Q5T0J7-1]
CCDS53433.1 [Q5T0J7-5]
CCDS53434.1 [Q5T0J7-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001164193.1, NM_001170722.1 [Q5T0J7-2]
NP_001164194.1, NM_001170723.1 [Q5T0J7-5]
NP_001164195.1, NM_001170724.1
NP_115502.2, NM_032126.4 [Q5T0J7-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000319416; ENSP00000323795; ENSG00000240021 [Q5T0J7-1]
ENST00000367639; ENSP00000356611; ENSG00000240021 [Q5T0J7-2]
ENST00000367641; ENSP00000356613; ENSG00000240021 [Q5T0J7-3]
ENST00000367643; ENSP00000356615; ENSG00000240021 [Q5T0J7-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84066

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84066

UCSC genome browser

More...
UCSCi
uc001glt.3, human [Q5T0J7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136694 mRNA Translation: CAB66629.1
AK093269 mRNA Translation: BAC04115.1
AK097518 mRNA Translation: BAC05085.1
AL513013 Genomic DNA No translation available.
BC034972 mRNA Translation: AAH34972.1
CCDSiCCDS1323.1 [Q5T0J7-1]
CCDS53433.1 [Q5T0J7-5]
CCDS53434.1 [Q5T0J7-2]
RefSeqiNP_001164193.1, NM_001170722.1 [Q5T0J7-2]
NP_001164194.1, NM_001170723.1 [Q5T0J7-5]
NP_001164195.1, NM_001170724.1
NP_115502.2, NM_032126.4 [Q5T0J7-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi123861, 33 interactors
IntActiQ5T0J7, 31 interactors
MINTiQ5T0J7
STRINGi9606.ENSP00000323795

PTM databases

iPTMnetiQ5T0J7
PhosphoSitePlusiQ5T0J7

Polymorphism and mutation databases

BioMutaiTEX35
DMDMi74744310

Proteomic databases

jPOSTiQ5T0J7
MassIVEiQ5T0J7
PaxDbiQ5T0J7
PeptideAtlasiQ5T0J7
PRIDEiQ5T0J7
ProteomicsDBi64172 [Q5T0J7-1]
64173 [Q5T0J7-2]
64174 [Q5T0J7-3]
64175 [Q5T0J7-4]
64176

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
50038, 88 antibodies

The DNASU plasmid repository

More...
DNASUi
84066

Genome annotation databases

EnsembliENST00000319416; ENSP00000323795; ENSG00000240021 [Q5T0J7-1]
ENST00000367639; ENSP00000356611; ENSG00000240021 [Q5T0J7-2]
ENST00000367641; ENSP00000356613; ENSG00000240021 [Q5T0J7-3]
ENST00000367643; ENSP00000356615; ENSG00000240021 [Q5T0J7-5]
GeneIDi84066
KEGGihsa:84066
UCSCiuc001glt.3, human [Q5T0J7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84066
DisGeNETi84066
EuPathDBiHostDB:ENSG00000240021.9

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TEX35
HGNCiHGNC:25366, TEX35
HPAiENSG00000240021, Tissue enriched (testis)
neXtProtiNX_Q5T0J7
OpenTargetsiENSG00000240021
PharmGKBiPA134904440

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502RVNR, Eukaryota
GeneTreeiENSGT00390000011962
HOGENOMiCLU_086070_0_0_1
InParanoidiQ5T0J7
OMAiKCILCAL
OrthoDBi1400673at2759
PhylomeDBiQ5T0J7
TreeFamiTF337831

Enzyme and pathway databases

PathwayCommonsiQ5T0J7

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
84066, 10 hits in 873 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TEX35, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
C1orf49

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84066
PharosiQ5T0J7, Tbio

Protein Ontology

More...
PROi
PR:Q5T0J7
RNActiQ5T0J7, protein

Gene expression databases

BgeeiENSG00000240021, Expressed in testis and 96 other tissues
ExpressionAtlasiQ5T0J7, baseline and differential
GenevisibleiQ5T0J7, HS

Family and domain databases

InterProiView protein in InterPro
IPR027874, Tex35
PANTHERiPTHR36860, PTHR36860, 1 hit
PfamiView protein in Pfam
PF15079, Tsc35, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTEX35_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5T0J7
Secondary accession number(s): Q5T0J8
, Q5T0J9, Q8IYU6, Q8N7Z1, Q8NA15, Q9H0Q7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: December 21, 2004
Last modified: October 7, 2020
This is version 116 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again