Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 112 (16 Oct 2019)
Sequence version 2 (10 Jun 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

NHS-like protein 1

Gene

NHSL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
NHS-like protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NHSL1
Synonyms:C6orf63, KIAA1357
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:21021 NHSL1

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5SYE7

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
57224

Open Targets

More...
OpenTargetsi
ENSG00000135540

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134929320

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q5SYE7

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NHSL1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
190360005

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003413531 – 1610NHS-like protein 1Add BLAST1610

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei24PhosphoserineBy similarity1
Modified residuei198PhosphoserineCombined sources1
Modified residuei328PhosphoserineCombined sources1
Modified residuei568PhosphoserineBy similarity1
Modified residuei639PhosphoserineBy similarity1
Modified residuei1089PhosphoserineBy similarity1
Modified residuei1167PhosphoserineCombined sources1
Modified residuei1233PhosphoserineCombined sources1
Modified residuei1386PhosphoserineCombined sources1
Modified residuei1388PhosphoserineCombined sources1
Modified residuei1392PhosphothreonineCombined sources1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5SYE7

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q5SYE7

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q5SYE7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5SYE7

PeptideAtlas

More...
PeptideAtlasi
Q5SYE7

PRoteomics IDEntifications database

More...
PRIDEi
Q5SYE7

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
64026 [Q5SYE7-1]
64027 [Q5SYE7-2]

PTM databases

CarbonylDB database of protein carbonylation sites

More...
CarbonylDBi
Q5SYE7

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5SYE7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5SYE7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Expressed in adult and fetal brain, fetal eyes, adult lens, kidney, liver and intestine.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000135540 Expressed in 193 organ(s), highest expression level in forebrain

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5SYE7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5SYE7 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA029966
HPA029967
HPA029968

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121460, 15 interactors

Database of interacting proteins

More...
DIPi
DIP-47303N

Protein interaction database and analysis system

More...
IntActi
Q5SYE7, 12 interactors

Molecular INTeraction database

More...
MINTi
Q5SYE7

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000394546

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi894 – 918Ser-richAdd BLAST25
Compositional biasi926 – 1070Pro-richAdd BLAST145

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the NHS family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IJSF Eukaryota
ENOG410XXZ7 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182963

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000113783

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5SYE7

Identification of Orthologs from Complete Genome Data

More...
OMAi
SEYADQW

Database of Orthologous Groups

More...
OrthoDBi
60972at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5SYE7

TreeFam database of animal gene trees

More...
TreeFami
TF333323

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR024845 NHS_fam

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15273 NHS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5SYE7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKKEGSSGSF RLQPNTGSLS RAVSWINFSS LSRQTKRLFR SDGELSVCGQ
60 70 80 90 100
QVEVDDENWI YRAQPRKAVS NLDEESRWTV HYTAPWHQQE NVFLPTTRPP
110 120 130 140 150
CVEDLHRQAK LNLKSVLREC DKLRHDGYRS SQYYSQGPTF AANASPFCDD
160 170 180 190 200
YQDEDEETDQ KCSLSSSEEE RFISIRRPKT PASSDFSDLN TQTNWTKSLP
210 220 230 240 250
LPTPEEKMRQ QAQTVQADVV PINITASGTG QDDADGHSVY TPDHYSTLGR
260 270 280 290 300
FNSCRSAGQR SETRDSSCQT EDVKVVPPSM RRIRAQKGQG IAAQMGHFSG
310 320 330 340 350
SSGNMSVLSD SAGIVFPSRL DSDAGFHSLP RSGARANIQS LEPRLGALGP
360 370 380 390 400
AGDMNGTFLY QRGHPQADEN LGHLGGASGT GTLLRPKSQE LRHFESENIM
410 420 430 440 450
SPACVVSPHA TYSTSIIPNA TLSSSSEVIA IPTAQSAGQR ESKSSGSSHA
460 470 480 490 500
RIKSRDHLIS RHAVKGDPQS PGRHWNEGHA TILSQDLDPH SPGEPALLSL
510 520 530 540 550
CDSAVPLNAP ANRENGSQAM PYNCRNNLAF PAHPQDVDGK SESSYSGGGG
560 570 580 590 600
HSSSEPWEYK SSGNGRASPL KPHLATPGYS TPTSNMSSCS LDQTSNKEDA
610 620 630 640 650
GSLYSEDHDG YCASVHTDSG HGSGNLCNSS DGFGNPRHSV INVFVGRAQK
660 670 680 690 700
NQGDRSNYQD KSLSRNISLK KAKKPPLPPS RTDSLRRIPK KSSQCNGQVL
710 720 730 740 750
NESLIATLQH SLQLSLPGKS GSSPSQSPCS DLEEPWLPRS RSQSTVSAGS
760 770 780 790 800
SMTSATTPNV YSLCGATPSQ SDTSSVKSEY TDPWGYYIDY TGMQEDPGNP
810 820 830 840 850
AGGCSTSSGV PTGNGPVRHV QEGSRATMPQ VPGGSVKPKI MSPEKSHRVI
860 870 880 890 900
SPSSGYSSQS NTPTALTPVP VFLKSVSPAN GKGKPKPKVP ERKSSLISSV
910 920 930 940 950
SISSSSTSLS SSTSTEGSGT MKKLDPAVGS PPAPPPPPVP SPPFPCPADR
960 970 980 990 1000
SPFLPPPPPV TDCSQGSPLP HSPVFPPPPP EALIPFCSPP DWCLSPPRPA
1010 1020 1030 1040 1050
LSPILPDSPV SLPLPPPLLP SSEPPPAPPL DPKFMKDTRP PFTNSGQPES
1060 1070 1080 1090 1100
SRGSLRPPST KEETSRPPMP LITTEALQMV QLRPVRKNSG AEAAQLSERT
1110 1120 1130 1140 1150
AQEQRTPVAP QYHLKPSAFL KSRNSTNEME SESQPASVTS SLPTPAKSSS
1160 1170 1180 1190 1200
QGDHGSAAER GGPVSRSPGA PSAGEAEARP SPSTTPLPDS SPSRKPPPIS
1210 1220 1230 1240 1250
KKPKLFLVVP PPQKDFAVEP AENVSEALRA VPSPTTGEEG SVHSREAKES
1260 1270 1280 1290 1300
SAAQAGSHAT HPGTSVLEGG AAGSMSPSRV EANVPMVQPD VSPAPKQEEP
1310 1320 1330 1340 1350
AENSADTGGD GESCLSQQDG AAGVPETNAA GSSSEACDFL KEDGNDEVMT
1360 1370 1380 1390 1400
PSRPRTTEDL FAAIHRSKRK VLGRRDSDDD HSRNHSPSPP VTPTGAAPSL
1410 1420 1430 1440 1450
ASPKQVGSIQ RSIRKSSTSS DNFKALLLKK GSRSDTSARM SAAEMLKNTD
1460 1470 1480 1490 1500
PRFQRSRSEP SPDAPESPSS CSPSKNRRAQ EEWAKNEGLM PRSLSFSGPR
1510 1520 1530 1540 1550
YGRSRTPPSA ASSRYSMRNR IQSSPMTVIS EGEGEAVEPV DSIARGALGA
1560 1570 1580 1590 1600
AEGCSLDGLA REEMDEGGLL CGEGPAASLQ PQAPGPVDGT ASAEGREPSP
1610
QCGGSLSEES
Length:1,610
Mass (Da):170,668
Last modified:June 10, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1E986A2304C5E4E5
GO
Isoform 2 (identifier: Q5SYE7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MKKEGSSGSF...WIYRAQPRKA → MVVFINAKIKSLIKLFKKKT
     225-225: T → TGENFDRQASLRRSLIYTDTLVRRPKKVKRRKTITGVPDNIQKEL

Show »
Length:1,606
Mass (Da):170,477
Checksum:i6CD70FAD11BAA616
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YDF6H0YDF6_HUMAN
NHS-like protein 1
NHSL1
169Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PMJ0E9PMJ0_HUMAN
NHS-like protein 1
NHSL1
137Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PAK2E9PAK2_HUMAN
NHS-like protein 1
NHSL1
221Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1487E → S in AAH45181 (PubMed:15489334).Curated1
Sequence conflicti1608E → K in AAH45181 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0440551085V → M. Corresponds to variant dbSNP:rs3734305Ensembl.1
Natural variantiVAR_0440561585G → S1 PublicationCorresponds to variant dbSNP:rs11540147Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0408181 – 68MKKEG…QPRKA → MVVFINAKIKSLIKLFKKKT in isoform 2. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_040819225T → TGENFDRQASLRRSLIYTDT LVRRPKKVKRRKTITGVPDN IQKEL in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK307584 mRNA No translation available.
AL391669 Genomic DNA No translation available.
AL591375 Genomic DNA No translation available.
AB037778 mRNA Translation: BAA92595.1
BC045181 mRNA Translation: AAH45181.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS47487.1 [Q5SYE7-2]
CCDS55063.1 [Q5SYE7-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001137532.1, NM_001144060.1 [Q5SYE7-2]
NP_065197.1, NM_020464.1 [Q5SYE7-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000343505; ENSP00000344672; ENSG00000135540 [Q5SYE7-2]
ENST00000427025; ENSP00000394546; ENSG00000135540 [Q5SYE7-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57224

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57224

UCSC genome browser

More...
UCSCi
uc003qhx.4 human [Q5SYE7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK307584 mRNA No translation available.
AL391669 Genomic DNA No translation available.
AL591375 Genomic DNA No translation available.
AB037778 mRNA Translation: BAA92595.1
BC045181 mRNA Translation: AAH45181.1
CCDSiCCDS47487.1 [Q5SYE7-2]
CCDS55063.1 [Q5SYE7-1]
RefSeqiNP_001137532.1, NM_001144060.1 [Q5SYE7-2]
NP_065197.1, NM_020464.1 [Q5SYE7-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi121460, 15 interactors
DIPiDIP-47303N
IntActiQ5SYE7, 12 interactors
MINTiQ5SYE7
STRINGi9606.ENSP00000394546

PTM databases

CarbonylDBiQ5SYE7
iPTMnetiQ5SYE7
PhosphoSitePlusiQ5SYE7

Polymorphism and mutation databases

BioMutaiNHSL1
DMDMi190360005

Proteomic databases

jPOSTiQ5SYE7
MassIVEiQ5SYE7
MaxQBiQ5SYE7
PaxDbiQ5SYE7
PeptideAtlasiQ5SYE7
PRIDEiQ5SYE7
ProteomicsDBi64026 [Q5SYE7-1]
64027 [Q5SYE7-2]

Genome annotation databases

EnsembliENST00000343505; ENSP00000344672; ENSG00000135540 [Q5SYE7-2]
ENST00000427025; ENSP00000394546; ENSG00000135540 [Q5SYE7-1]
GeneIDi57224
KEGGihsa:57224
UCSCiuc003qhx.4 human [Q5SYE7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57224
DisGeNETi57224

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NHSL1
HGNCiHGNC:21021 NHSL1
HPAiHPA029966
HPA029967
HPA029968
neXtProtiNX_Q5SYE7
OpenTargetsiENSG00000135540
PharmGKBiPA134929320

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IJSF Eukaryota
ENOG410XXZ7 LUCA
GeneTreeiENSGT00950000182963
HOGENOMiHOG000113783
InParanoidiQ5SYE7
OMAiSEYADQW
OrthoDBi60972at2759
PhylomeDBiQ5SYE7
TreeFamiTF333323

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NHSL1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57224
PharosiQ5SYE7

Protein Ontology

More...
PROi
PR:Q5SYE7

Gene expression databases

BgeeiENSG00000135540 Expressed in 193 organ(s), highest expression level in forebrain
ExpressionAtlasiQ5SYE7 baseline and differential
GenevisibleiQ5SYE7 HS

Family and domain databases

InterProiView protein in InterPro
IPR024845 NHS_fam
PfamiView protein in Pfam
PF15273 NHS, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNHSL1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5SYE7
Secondary accession number(s): Q3ZCS5, Q5SYE8, Q9P2J0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: June 10, 2008
Last modified: October 16, 2019
This is version 112 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again